Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J8QA75

Protein Details
Accession A0A1J8QA75    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
104-123DDPTRRSSNRTRRPAPKVRDBasic
NLS Segment(s)
PositionSequence
146-166KDKPTPRKRRSAGSGNKRRRR
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MTSIRWKPQITYRSPSAGTSTLHLEGPPVGSDASSSSQSPSPHSLPLQLSLQGSIYQSSQSKRHKRWMIGPSLPLYHPLGRLALSLPDLDPTAFGLPAPAVIIDDPTRRSSNRTRRPAPKVRDANEPAPSPIPFIDVVPAPEPELKDKPTPRKRRSAGSGNKRRRREIDDGDATYPAKRTRIPRNSAATATAQTSTGGEPSPPSSIDNSALSPGGDQDGPERPERRTARSRGTRARKDSTASEATVTSVAASIVATNTASHKGGGEDSLDADVSPSSVLQDAEMATDANLIKDTSSDGDDKVASNVPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.47
4 0.41
5 0.36
6 0.31
7 0.3
8 0.25
9 0.25
10 0.23
11 0.19
12 0.17
13 0.17
14 0.15
15 0.12
16 0.1
17 0.1
18 0.1
19 0.12
20 0.13
21 0.14
22 0.14
23 0.15
24 0.19
25 0.2
26 0.24
27 0.27
28 0.27
29 0.29
30 0.3
31 0.33
32 0.31
33 0.33
34 0.31
35 0.28
36 0.26
37 0.23
38 0.23
39 0.18
40 0.17
41 0.15
42 0.13
43 0.14
44 0.16
45 0.19
46 0.27
47 0.36
48 0.45
49 0.5
50 0.6
51 0.65
52 0.67
53 0.74
54 0.74
55 0.73
56 0.68
57 0.65
58 0.57
59 0.52
60 0.47
61 0.4
62 0.34
63 0.27
64 0.23
65 0.2
66 0.18
67 0.16
68 0.16
69 0.14
70 0.12
71 0.11
72 0.11
73 0.1
74 0.1
75 0.1
76 0.09
77 0.08
78 0.08
79 0.08
80 0.07
81 0.07
82 0.07
83 0.06
84 0.06
85 0.06
86 0.05
87 0.04
88 0.04
89 0.06
90 0.08
91 0.1
92 0.12
93 0.15
94 0.17
95 0.17
96 0.23
97 0.32
98 0.41
99 0.49
100 0.57
101 0.63
102 0.7
103 0.79
104 0.83
105 0.8
106 0.79
107 0.77
108 0.7
109 0.71
110 0.67
111 0.62
112 0.57
113 0.51
114 0.42
115 0.35
116 0.32
117 0.23
118 0.18
119 0.15
120 0.11
121 0.1
122 0.1
123 0.09
124 0.1
125 0.1
126 0.1
127 0.09
128 0.11
129 0.11
130 0.14
131 0.15
132 0.17
133 0.21
134 0.27
135 0.37
136 0.46
137 0.56
138 0.58
139 0.65
140 0.66
141 0.67
142 0.68
143 0.68
144 0.68
145 0.68
146 0.74
147 0.74
148 0.8
149 0.76
150 0.73
151 0.67
152 0.64
153 0.61
154 0.56
155 0.55
156 0.52
157 0.5
158 0.47
159 0.44
160 0.37
161 0.3
162 0.25
163 0.17
164 0.13
165 0.15
166 0.2
167 0.3
168 0.39
169 0.44
170 0.49
171 0.55
172 0.56
173 0.53
174 0.49
175 0.4
176 0.32
177 0.28
178 0.21
179 0.14
180 0.11
181 0.11
182 0.1
183 0.09
184 0.08
185 0.07
186 0.07
187 0.08
188 0.1
189 0.09
190 0.1
191 0.11
192 0.13
193 0.15
194 0.15
195 0.14
196 0.14
197 0.14
198 0.12
199 0.11
200 0.09
201 0.09
202 0.08
203 0.07
204 0.09
205 0.15
206 0.17
207 0.22
208 0.24
209 0.23
210 0.33
211 0.36
212 0.41
213 0.44
214 0.48
215 0.54
216 0.62
217 0.7
218 0.71
219 0.78
220 0.8
221 0.78
222 0.78
223 0.71
224 0.65
225 0.59
226 0.55
227 0.48
228 0.4
229 0.34
230 0.27
231 0.25
232 0.22
233 0.18
234 0.11
235 0.08
236 0.07
237 0.06
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.06
244 0.08
245 0.11
246 0.11
247 0.11
248 0.12
249 0.12
250 0.13
251 0.14
252 0.13
253 0.11
254 0.12
255 0.12
256 0.11
257 0.1
258 0.09
259 0.08
260 0.07
261 0.07
262 0.06
263 0.06
264 0.07
265 0.08
266 0.07
267 0.09
268 0.09
269 0.1
270 0.1
271 0.09
272 0.08
273 0.11
274 0.11
275 0.1
276 0.11
277 0.1
278 0.1
279 0.1
280 0.12
281 0.11
282 0.14
283 0.15
284 0.15
285 0.17
286 0.18
287 0.19
288 0.19