Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J8Q650

Protein Details
Accession A0A1J8Q650   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-28RNVLPLSRSLRPPRRRSPRGGTWVAHydrophilic
NLS Segment(s)
PositionSequence
14-20RPPRRRS
Subcellular Location(s) mito 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR014746  Gln_synth/guanido_kin_cat_dom  
IPR008146  Gln_synth_cat_dom  
Gene Ontology GO:0004356  F:glutamate-ammonia ligase activity  
GO:0006807  P:nitrogen compound metabolic process  
Pfam View protein in Pfam  
PF00120  Gln-synt_C  
Amino Acid Sequences MRRRNVLPLSRSLRPPRRRSPRGGTWVAWGSDNREVPVRLCVPPTRFPTPSQQKRTSPTPSGNHFEIKCIDGTSSPYLALAALLGAGLLGIQSQAPLVEKNCTEAAAEMSEAERDAVGVRRRLPLTWEEARGALEGDEAMKGLFGGIVDGFLAAGRILDDLMNTPTTEAGRVQLLVENY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.77
4 0.82
5 0.84
6 0.84
7 0.83
8 0.83
9 0.82
10 0.79
11 0.69
12 0.64
13 0.61
14 0.53
15 0.45
16 0.35
17 0.3
18 0.31
19 0.3
20 0.25
21 0.24
22 0.24
23 0.22
24 0.28
25 0.27
26 0.22
27 0.25
28 0.29
29 0.3
30 0.37
31 0.42
32 0.42
33 0.41
34 0.42
35 0.49
36 0.56
37 0.61
38 0.62
39 0.64
40 0.62
41 0.66
42 0.7
43 0.66
44 0.6
45 0.58
46 0.55
47 0.53
48 0.53
49 0.5
50 0.48
51 0.41
52 0.38
53 0.32
54 0.27
55 0.22
56 0.17
57 0.15
58 0.11
59 0.14
60 0.13
61 0.12
62 0.11
63 0.1
64 0.1
65 0.09
66 0.09
67 0.05
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.01
75 0.01
76 0.01
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.03
83 0.04
84 0.05
85 0.07
86 0.08
87 0.1
88 0.11
89 0.11
90 0.1
91 0.1
92 0.1
93 0.09
94 0.09
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.04
101 0.04
102 0.05
103 0.1
104 0.14
105 0.16
106 0.18
107 0.23
108 0.24
109 0.24
110 0.26
111 0.24
112 0.27
113 0.29
114 0.29
115 0.26
116 0.25
117 0.26
118 0.23
119 0.21
120 0.13
121 0.09
122 0.07
123 0.06
124 0.06
125 0.05
126 0.05
127 0.04
128 0.04
129 0.04
130 0.04
131 0.03
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.03
141 0.03
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.07
148 0.09
149 0.1
150 0.1
151 0.1
152 0.12
153 0.12
154 0.13
155 0.12
156 0.12
157 0.13
158 0.13
159 0.14