Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QVF8

Protein Details
Accession A0A1J9QVF8   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-40NRSLSRKTLLRKSSKRKRKGLHLEKSRAKABasic
NLS Segment(s)
PositionSequence
16-45RKTLLRKSSKRKRKGLHLEKSRAKAEARKS
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037045  S8pro/Inhibitor_I9_sf  
Amino Acid Sequences MPSRFGQGALNRSLSRKTLLRKSSKRKRKGLHLEKSRAKAEARKSGGTIKHEYTLIKGFTVEYPDDHIKVLETTEHLHVEQDGQVRTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.31
4 0.35
5 0.39
6 0.47
7 0.56
8 0.63
9 0.73
10 0.79
11 0.84
12 0.86
13 0.87
14 0.85
15 0.85
16 0.87
17 0.86
18 0.86
19 0.85
20 0.85
21 0.82
22 0.79
23 0.69
24 0.6
25 0.51
26 0.46
27 0.42
28 0.42
29 0.39
30 0.35
31 0.35
32 0.38
33 0.39
34 0.38
35 0.35
36 0.27
37 0.25
38 0.26
39 0.25
40 0.22
41 0.23
42 0.19
43 0.15
44 0.14
45 0.13
46 0.13
47 0.16
48 0.14
49 0.11
50 0.16
51 0.18
52 0.19
53 0.18
54 0.17
55 0.15
56 0.15
57 0.15
58 0.11
59 0.1
60 0.13
61 0.15
62 0.17
63 0.16
64 0.16
65 0.16
66 0.16
67 0.18
68 0.21