Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PS24

Protein Details
Accession A0A1J9PS24    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
47-66PYLHHSSHRSRPRIKSQQTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MAPKRLSSMDAILTLPPNPPDEGLQRWITAIRAVTVSCSVEEGRSLPYLHHSSHRSRPRIKSQQTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.14
5 0.13
6 0.13
7 0.15
8 0.17
9 0.19
10 0.22
11 0.22
12 0.2
13 0.2
14 0.19
15 0.17
16 0.15
17 0.12
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.09
24 0.07
25 0.08
26 0.08
27 0.07
28 0.08
29 0.08
30 0.09
31 0.11
32 0.11
33 0.1
34 0.16
35 0.19
36 0.2
37 0.26
38 0.28
39 0.33
40 0.43
41 0.52
42 0.54
43 0.6
44 0.68
45 0.72
46 0.79