Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3BE89

Protein Details
Accession G3BE89    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-32HTAHNQSKKAHRNGIKKPKTNRYPSLHydrophilic
NLS Segment(s)
PositionSequence
14-43KKAHRNGIKKPKTNRYPSLKGVDAKFRRNH
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cten:CANTEDRAFT_116545  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTAHNQSKKAHRNGIKKPKTNRYPSLKGVDAKFRRNHRYALHGTAKTLAKARAEKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.76
3 0.75
4 0.73
5 0.72
6 0.75
7 0.81
8 0.81
9 0.8
10 0.81
11 0.82
12 0.83
13 0.81
14 0.79
15 0.76
16 0.73
17 0.69
18 0.66
19 0.58
20 0.52
21 0.47
22 0.48
23 0.43
24 0.44
25 0.46
26 0.48
27 0.52
28 0.52
29 0.55
30 0.48
31 0.53
32 0.5
33 0.53
34 0.54
35 0.47
36 0.45
37 0.46
38 0.45
39 0.38
40 0.38
41 0.32
42 0.3
43 0.35