Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9Q0A3

Protein Details
Accession A0A1J9Q0A3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
4-28HEEYYVKKILKKKIRYRQKHYLIKWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
Amino Acid Sequences VDEHEEYYVKKILKKKIRYRQKHYLIKWVSWTAPTWVKTSLMKETQTLDNYLQRTTRGKKKSNVRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.72
4 0.81
5 0.86
6 0.88
7 0.88
8 0.89
9 0.88
10 0.8
11 0.8
12 0.71
13 0.62
14 0.57
15 0.48
16 0.38
17 0.29
18 0.28
19 0.2
20 0.22
21 0.22
22 0.19
23 0.18
24 0.19
25 0.2
26 0.22
27 0.25
28 0.24
29 0.23
30 0.23
31 0.25
32 0.28
33 0.28
34 0.28
35 0.25
36 0.26
37 0.26
38 0.27
39 0.25
40 0.23
41 0.29
42 0.35
43 0.42
44 0.46
45 0.53
46 0.6