Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PB62

Protein Details
Accession A0A1J9PB62    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-38YSDLYPQVKKRTKWKEKIKNLPRRLKYFLHydrophilic
NLS Segment(s)
PositionSequence
18-33KKRTKWKEKIKNLPRR
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MMMDEKLPSYSDLYPQVKKRTKWKEKIKNLPRRLKYFLDSIEEDRRAREWEAAMLHGNLLKFMSHMKCVEPRAIYANLPKRLQATLKIGGWTRASRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.51
4 0.55
5 0.58
6 0.65
7 0.67
8 0.73
9 0.78
10 0.82
11 0.83
12 0.86
13 0.93
14 0.93
15 0.92
16 0.92
17 0.91
18 0.87
19 0.82
20 0.77
21 0.69
22 0.61
23 0.54
24 0.46
25 0.41
26 0.36
27 0.33
28 0.33
29 0.32
30 0.29
31 0.26
32 0.25
33 0.22
34 0.21
35 0.18
36 0.13
37 0.13
38 0.14
39 0.14
40 0.14
41 0.12
42 0.11
43 0.11
44 0.1
45 0.08
46 0.08
47 0.06
48 0.06
49 0.1
50 0.11
51 0.13
52 0.14
53 0.16
54 0.21
55 0.23
56 0.27
57 0.24
58 0.24
59 0.26
60 0.27
61 0.26
62 0.3
63 0.37
64 0.39
65 0.39
66 0.39
67 0.36
68 0.38
69 0.38
70 0.36
71 0.33
72 0.33
73 0.35
74 0.37
75 0.37
76 0.37
77 0.39