Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9P1M6

Protein Details
Accession A0A1J9P1M6    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-30VPAPSLKHLKRTPKKKSVQSLLFSHydrophilic
47-99VRNTSFTTPRSRRRPRPGKPILKPTPPTKKTAPPDKKTNTKTPVKKTPPVKTSHydrophilic
NLS Segment(s)
PositionSequence
56-94RSRRRPRPGKPILKPTPPTKKTAPPDKKTNTKTPVKKTP
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MKEPSTVPAPSLKHLKRTPKKKSVQSLLFSPLFALANDEDLESFEDVRNTSFTTPRSRRRPRPGKPILKPTPPTKKTAPPDKKTNTKTPVKKTPPVKTSALCRSARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.6
3 0.63
4 0.72
5 0.77
6 0.77
7 0.84
8 0.84
9 0.88
10 0.86
11 0.84
12 0.77
13 0.7
14 0.66
15 0.57
16 0.47
17 0.37
18 0.28
19 0.21
20 0.17
21 0.15
22 0.09
23 0.09
24 0.1
25 0.1
26 0.08
27 0.08
28 0.09
29 0.07
30 0.08
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.11
39 0.13
40 0.21
41 0.28
42 0.36
43 0.46
44 0.55
45 0.63
46 0.72
47 0.81
48 0.8
49 0.85
50 0.86
51 0.86
52 0.84
53 0.85
54 0.81
55 0.78
56 0.74
57 0.72
58 0.73
59 0.64
60 0.62
61 0.57
62 0.59
63 0.59
64 0.66
65 0.68
66 0.64
67 0.72
68 0.75
69 0.8
70 0.77
71 0.79
72 0.76
73 0.76
74 0.78
75 0.77
76 0.8
77 0.78
78 0.79
79 0.79
80 0.81
81 0.76
82 0.72
83 0.68
84 0.62
85 0.63
86 0.65
87 0.64