Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PLM9

Protein Details
Accession A0A1J9PLM9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-66DEGQTPKRRGPKPDSKPAQTRRQELNRQAQRTHRERKEQYIRAHydrophilic
NLS Segment(s)
PositionSequence
30-40KRRGPKPDSKP
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MASVRQHNGSASDHHTPNNGNAGDEGQTPKRRGPKPDSKPAQTRRQELNRQAQRTHRERKEQYIRALETEISRLRECYSNDMSASNISIQQQKKVLQEQKEENATLRQILAAHGIPFEAELEQRKAALRSAGGRHGPTPAFDGNTSYSHSQSQSPSHAHSHSQGFIGDGNYLTATPPTTVSAVSPGTSSHYADAQHSRNTFSSYPGVSQGLQNEHPGVLAESNAWWGGDGGSTVDDMPGIFEKDPQLGVEFILSLEEPCRTHMEFLCRRAEDDEEAEMISGHVLMASCPPPTQIVSAEPGQMYPLRTYELPHTNLARLLNLSRQLVTDGQITPIMALQYLKSHDIYPSLTREDVRHMMDDLNGKIRCYGFGAVIEDFEFMDSFSSVLAGKLEPLMDTTTPDGSDSKALPAAPRQRLSDDILYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.36
4 0.37
5 0.4
6 0.34
7 0.27
8 0.26
9 0.26
10 0.24
11 0.25
12 0.27
13 0.26
14 0.33
15 0.34
16 0.4
17 0.48
18 0.52
19 0.58
20 0.63
21 0.67
22 0.7
23 0.79
24 0.82
25 0.81
26 0.86
27 0.86
28 0.86
29 0.83
30 0.81
31 0.8
32 0.8
33 0.81
34 0.8
35 0.82
36 0.81
37 0.78
38 0.76
39 0.74
40 0.74
41 0.73
42 0.75
43 0.72
44 0.74
45 0.74
46 0.79
47 0.82
48 0.79
49 0.78
50 0.76
51 0.69
52 0.61
53 0.58
54 0.49
55 0.39
56 0.38
57 0.33
58 0.28
59 0.26
60 0.25
61 0.25
62 0.29
63 0.29
64 0.31
65 0.31
66 0.3
67 0.3
68 0.3
69 0.28
70 0.24
71 0.23
72 0.17
73 0.15
74 0.14
75 0.21
76 0.22
77 0.25
78 0.28
79 0.31
80 0.35
81 0.42
82 0.47
83 0.47
84 0.53
85 0.56
86 0.58
87 0.57
88 0.53
89 0.45
90 0.41
91 0.35
92 0.28
93 0.22
94 0.17
95 0.13
96 0.13
97 0.14
98 0.12
99 0.12
100 0.11
101 0.11
102 0.09
103 0.09
104 0.09
105 0.07
106 0.07
107 0.1
108 0.12
109 0.13
110 0.14
111 0.15
112 0.16
113 0.16
114 0.17
115 0.15
116 0.18
117 0.21
118 0.26
119 0.27
120 0.27
121 0.26
122 0.29
123 0.27
124 0.22
125 0.23
126 0.19
127 0.18
128 0.17
129 0.19
130 0.17
131 0.18
132 0.2
133 0.17
134 0.17
135 0.17
136 0.18
137 0.19
138 0.19
139 0.21
140 0.24
141 0.24
142 0.26
143 0.28
144 0.28
145 0.26
146 0.27
147 0.27
148 0.23
149 0.22
150 0.19
151 0.16
152 0.16
153 0.15
154 0.11
155 0.08
156 0.07
157 0.07
158 0.07
159 0.06
160 0.05
161 0.05
162 0.05
163 0.06
164 0.07
165 0.07
166 0.07
167 0.07
168 0.09
169 0.09
170 0.09
171 0.09
172 0.08
173 0.11
174 0.11
175 0.12
176 0.1
177 0.11
178 0.11
179 0.14
180 0.19
181 0.18
182 0.21
183 0.21
184 0.22
185 0.21
186 0.24
187 0.23
188 0.2
189 0.2
190 0.17
191 0.17
192 0.16
193 0.17
194 0.14
195 0.14
196 0.14
197 0.14
198 0.14
199 0.14
200 0.13
201 0.12
202 0.11
203 0.1
204 0.08
205 0.06
206 0.05
207 0.05
208 0.04
209 0.05
210 0.05
211 0.05
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.03
224 0.04
225 0.05
226 0.06
227 0.06
228 0.07
229 0.08
230 0.09
231 0.09
232 0.09
233 0.09
234 0.08
235 0.08
236 0.07
237 0.06
238 0.05
239 0.05
240 0.05
241 0.04
242 0.05
243 0.06
244 0.06
245 0.08
246 0.11
247 0.11
248 0.14
249 0.17
250 0.26
251 0.29
252 0.34
253 0.38
254 0.35
255 0.36
256 0.35
257 0.34
258 0.26
259 0.23
260 0.2
261 0.14
262 0.14
263 0.13
264 0.11
265 0.09
266 0.07
267 0.05
268 0.03
269 0.04
270 0.04
271 0.04
272 0.07
273 0.08
274 0.08
275 0.08
276 0.09
277 0.1
278 0.11
279 0.12
280 0.11
281 0.12
282 0.15
283 0.16
284 0.17
285 0.16
286 0.15
287 0.15
288 0.16
289 0.15
290 0.13
291 0.12
292 0.13
293 0.13
294 0.15
295 0.21
296 0.26
297 0.27
298 0.3
299 0.31
300 0.3
301 0.32
302 0.31
303 0.25
304 0.2
305 0.19
306 0.19
307 0.21
308 0.21
309 0.19
310 0.19
311 0.2
312 0.19
313 0.19
314 0.18
315 0.15
316 0.15
317 0.15
318 0.15
319 0.13
320 0.13
321 0.12
322 0.09
323 0.09
324 0.08
325 0.11
326 0.13
327 0.15
328 0.15
329 0.15
330 0.16
331 0.18
332 0.2
333 0.21
334 0.23
335 0.24
336 0.25
337 0.25
338 0.26
339 0.3
340 0.32
341 0.3
342 0.27
343 0.26
344 0.25
345 0.27
346 0.3
347 0.26
348 0.29
349 0.27
350 0.26
351 0.28
352 0.27
353 0.25
354 0.24
355 0.23
356 0.16
357 0.19
358 0.22
359 0.19
360 0.19
361 0.19
362 0.15
363 0.14
364 0.13
365 0.1
366 0.07
367 0.08
368 0.07
369 0.06
370 0.06
371 0.07
372 0.06
373 0.07
374 0.08
375 0.07
376 0.08
377 0.09
378 0.1
379 0.09
380 0.11
381 0.13
382 0.13
383 0.15
384 0.16
385 0.17
386 0.17
387 0.18
388 0.17
389 0.15
390 0.19
391 0.18
392 0.19
393 0.2
394 0.2
395 0.22
396 0.3
397 0.38
398 0.43
399 0.46
400 0.46
401 0.47
402 0.5
403 0.54