Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BC03

Protein Details
Accession G3BC03    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-118GQEVKKTPKQPKEQKEKKVKKDKHTKEDIWBasic
NLS Segment(s)
PositionSequence
93-112KKTPKQPKEQKEKKVKKDKH
Subcellular Location(s) nucl 14, cyto_nucl 11.833, mito_nucl 8.833, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020428  PFA-DSPs  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR004861  Siw14-like  
Gene Ontology GO:0016791  F:phosphatase activity  
KEGG cten:CANTEDRAFT_116819  -  
Pfam View protein in Pfam  
PF03162  Y_phosphatase2  
Amino Acid Sequences MARVSEANTIPTSPDRDAYHDNGLKLPADGQLDNGVPVFTANARPPLVPPLNFSLVEDRIYRSGFPNPLNYPFLKQLGLKTIIYLGDLGQEVKKTPKQPKEQKEKKVKKDKHTKEDIWNEYNAWIGTTNIQFHHLVMESSQEPFTSLQEQQQARDSLRTALQLMLDKNNFPMLIHSNKGKHRIGVLVGLMRKIFQGWCMSGIFEEYEKFALGKSEFDLEFMELWQPELWVSQDSRPEFLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.31
4 0.35
5 0.37
6 0.44
7 0.42
8 0.42
9 0.39
10 0.39
11 0.33
12 0.28
13 0.25
14 0.18
15 0.18
16 0.17
17 0.16
18 0.18
19 0.18
20 0.18
21 0.17
22 0.13
23 0.1
24 0.1
25 0.09
26 0.07
27 0.11
28 0.12
29 0.16
30 0.17
31 0.18
32 0.19
33 0.27
34 0.3
35 0.27
36 0.29
37 0.3
38 0.33
39 0.32
40 0.32
41 0.29
42 0.25
43 0.26
44 0.24
45 0.2
46 0.19
47 0.2
48 0.19
49 0.17
50 0.21
51 0.24
52 0.25
53 0.29
54 0.29
55 0.33
56 0.35
57 0.33
58 0.31
59 0.3
60 0.3
61 0.25
62 0.23
63 0.21
64 0.23
65 0.26
66 0.22
67 0.19
68 0.19
69 0.18
70 0.17
71 0.15
72 0.09
73 0.07
74 0.08
75 0.08
76 0.07
77 0.08
78 0.08
79 0.13
80 0.17
81 0.22
82 0.3
83 0.38
84 0.48
85 0.58
86 0.67
87 0.74
88 0.8
89 0.83
90 0.86
91 0.87
92 0.87
93 0.88
94 0.86
95 0.85
96 0.87
97 0.86
98 0.84
99 0.83
100 0.77
101 0.75
102 0.76
103 0.7
104 0.61
105 0.52
106 0.43
107 0.34
108 0.31
109 0.22
110 0.13
111 0.08
112 0.06
113 0.08
114 0.09
115 0.1
116 0.09
117 0.11
118 0.11
119 0.11
120 0.12
121 0.1
122 0.09
123 0.08
124 0.1
125 0.08
126 0.1
127 0.1
128 0.08
129 0.09
130 0.09
131 0.11
132 0.11
133 0.12
134 0.13
135 0.21
136 0.21
137 0.21
138 0.26
139 0.27
140 0.24
141 0.26
142 0.24
143 0.18
144 0.19
145 0.19
146 0.15
147 0.14
148 0.15
149 0.16
150 0.16
151 0.2
152 0.19
153 0.18
154 0.18
155 0.18
156 0.17
157 0.14
158 0.15
159 0.15
160 0.18
161 0.2
162 0.24
163 0.29
164 0.33
165 0.4
166 0.38
167 0.35
168 0.33
169 0.34
170 0.31
171 0.28
172 0.26
173 0.24
174 0.23
175 0.23
176 0.21
177 0.18
178 0.17
179 0.15
180 0.13
181 0.11
182 0.14
183 0.14
184 0.16
185 0.17
186 0.17
187 0.16
188 0.17
189 0.15
190 0.11
191 0.11
192 0.1
193 0.1
194 0.11
195 0.1
196 0.09
197 0.13
198 0.13
199 0.13
200 0.14
201 0.18
202 0.17
203 0.18
204 0.19
205 0.16
206 0.16
207 0.15
208 0.17
209 0.12
210 0.14
211 0.13
212 0.12
213 0.11
214 0.12
215 0.13
216 0.13
217 0.15
218 0.18
219 0.26
220 0.27
221 0.3