Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QHQ8

Protein Details
Accession A0A1J9QHQ8   
Localization Confidence High
Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
78-100ANITSTKKPRGRKPTSKEPKAELHydrophilic
NLS Segment(s)
PositionSequence
69-71KRK
82-95STKKPRGRKPTSKE
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MVNWNDAADRALLLNVIDPVAKPNWDRVAASMGNGFTAEACRQHFRKLKNEVFGDNSPATTSPSPSKAKRKTNGAHEANITSTKKPRGRKPTSKEPKAELTNSNTDTDDKNEISANNKADNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.1
7 0.11
8 0.13
9 0.13
10 0.18
11 0.22
12 0.24
13 0.24
14 0.22
15 0.27
16 0.25
17 0.25
18 0.22
19 0.17
20 0.15
21 0.15
22 0.13
23 0.07
24 0.09
25 0.09
26 0.09
27 0.11
28 0.16
29 0.17
30 0.26
31 0.31
32 0.34
33 0.42
34 0.49
35 0.52
36 0.54
37 0.55
38 0.48
39 0.48
40 0.44
41 0.4
42 0.3
43 0.25
44 0.18
45 0.17
46 0.17
47 0.12
48 0.13
49 0.11
50 0.16
51 0.21
52 0.26
53 0.36
54 0.42
55 0.5
56 0.54
57 0.61
58 0.61
59 0.66
60 0.72
61 0.65
62 0.59
63 0.51
64 0.47
65 0.39
66 0.38
67 0.31
68 0.22
69 0.24
70 0.3
71 0.34
72 0.41
73 0.49
74 0.55
75 0.64
76 0.73
77 0.77
78 0.8
79 0.85
80 0.87
81 0.82
82 0.76
83 0.74
84 0.69
85 0.64
86 0.58
87 0.53
88 0.52
89 0.49
90 0.46
91 0.38
92 0.34
93 0.32
94 0.31
95 0.3
96 0.22
97 0.22
98 0.22
99 0.22
100 0.25
101 0.29
102 0.29