Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9QEG5

Protein Details
Accession A0A1J9QEG5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-71GSDAPCDRRKVKRRRRRLRYKPNTPVPKGABasic
NLS Segment(s)
PositionSequence
49-63RRKVKRRRRRLRYKP
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MPRRRRGRPTSSSGSGTTDQLSPFATDSESDRGYETELTEPGSDAPCDRRKVKRRRRRLRYKPNTPVPKGAAASATDDSDDELNRRRTIPLQWLAKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.47
3 0.4
4 0.33
5 0.26
6 0.21
7 0.18
8 0.18
9 0.13
10 0.12
11 0.11
12 0.1
13 0.09
14 0.12
15 0.15
16 0.15
17 0.14
18 0.15
19 0.14
20 0.15
21 0.15
22 0.13
23 0.11
24 0.11
25 0.12
26 0.11
27 0.11
28 0.1
29 0.1
30 0.09
31 0.08
32 0.14
33 0.18
34 0.21
35 0.25
36 0.34
37 0.43
38 0.54
39 0.65
40 0.69
41 0.76
42 0.84
43 0.91
44 0.93
45 0.94
46 0.95
47 0.94
48 0.95
49 0.94
50 0.93
51 0.92
52 0.84
53 0.78
54 0.69
55 0.63
56 0.53
57 0.43
58 0.34
59 0.25
60 0.26
61 0.21
62 0.18
63 0.13
64 0.12
65 0.13
66 0.12
67 0.12
68 0.11
69 0.18
70 0.22
71 0.24
72 0.25
73 0.26
74 0.28
75 0.34
76 0.41
77 0.43
78 0.46