Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9P2Z1

Protein Details
Accession A0A1J9P2Z1    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-30KGPSASPAPTPKRPKRTPKKNAAQSPPSSHydrophilic
55-80TTPKANKKKAPAKKAKAKSTPAKKKAHydrophilic
NLS Segment(s)
PositionSequence
11-21TPKRPKRTPKK
58-111KANKKKAPAKKAKAKSTPAKKKAVPAPKGVTKTLVKKTTPGKAPAPRRSARKSA
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MKGPSASPAPTPKRPKRTPKKNAAQSPPSSPLPQPANDDDLESFEELCITDTPSTTPKANKKKAPAKKAKAKSTPAKKKAVPAPKGVTKTLVKKTTPGKAPAPRRSARKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.86
4 0.9
5 0.91
6 0.92
7 0.93
8 0.92
9 0.92
10 0.9
11 0.87
12 0.79
13 0.75
14 0.69
15 0.61
16 0.53
17 0.43
18 0.41
19 0.36
20 0.34
21 0.32
22 0.29
23 0.29
24 0.27
25 0.28
26 0.21
27 0.19
28 0.18
29 0.14
30 0.11
31 0.08
32 0.08
33 0.07
34 0.08
35 0.06
36 0.07
37 0.07
38 0.07
39 0.08
40 0.1
41 0.12
42 0.12
43 0.17
44 0.25
45 0.35
46 0.41
47 0.45
48 0.53
49 0.61
50 0.69
51 0.74
52 0.76
53 0.76
54 0.8
55 0.84
56 0.84
57 0.81
58 0.81
59 0.8
60 0.8
61 0.82
62 0.78
63 0.76
64 0.69
65 0.69
66 0.7
67 0.7
68 0.63
69 0.6
70 0.6
71 0.6
72 0.61
73 0.54
74 0.51
75 0.46
76 0.51
77 0.52
78 0.51
79 0.45
80 0.48
81 0.54
82 0.57
83 0.58
84 0.55
85 0.55
86 0.58
87 0.68
88 0.71
89 0.73
90 0.71
91 0.73