Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PVV9

Protein Details
Accession A0A1J9PVV9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
233-254AYIKGKEEKARREKARKEKAFVBasic
NLS Segment(s)
PositionSequence
35-68PAARHGKREGPSEPPRAANPANARAPRPGRGGGG
236-252KGKEEKARREKARKEKA
264-316PRGGRGGGEGGHRGGRGGRGGERGHGGRGGAGGRGRGGEFRGGAPRGGRGGPP
Subcellular Location(s) cyto_nucl 9.5, cyto 8.5, nucl 7.5, mito 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039764  HABP4/SERBP1  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF09598  Stm1_N  
Amino Acid Sequences MSDVRSKNLYELLGNDPEEDSDREPEPPTTAITKPAARHGKREGPSEPPRAANPANARAPRPGRGGGGRYGNEQAFRDRDASARANRSKPVDAPLPDIPTGVVKNRDVRGNLLREDRTNRSDRTVTSKQVEQGWGATSGESAWEDERAGEATARKEGREGSAGEGNNADAEAAAAAAEAEDKAKSYAEYLAEQAEQRREDLGVKEARKPNEGVKADKKWATAKELKRDDDEEAYIKGKEEKARREKARKEKAFVEVDMRFVEQPRGGRGGGEGGHRGGRGGRGGERGHGGRGGAGGRGRGGEFRGGAPRGGRGGPPAGPSVNVDEKNFPALGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.23
4 0.23
5 0.25
6 0.24
7 0.21
8 0.19
9 0.2
10 0.22
11 0.24
12 0.24
13 0.24
14 0.22
15 0.23
16 0.23
17 0.23
18 0.26
19 0.29
20 0.32
21 0.31
22 0.4
23 0.48
24 0.45
25 0.51
26 0.54
27 0.59
28 0.58
29 0.62
30 0.56
31 0.55
32 0.61
33 0.61
34 0.56
35 0.49
36 0.46
37 0.47
38 0.45
39 0.42
40 0.41
41 0.41
42 0.46
43 0.46
44 0.47
45 0.49
46 0.51
47 0.49
48 0.46
49 0.41
50 0.37
51 0.39
52 0.4
53 0.37
54 0.41
55 0.37
56 0.35
57 0.37
58 0.34
59 0.31
60 0.29
61 0.28
62 0.23
63 0.24
64 0.23
65 0.2
66 0.2
67 0.23
68 0.28
69 0.3
70 0.37
71 0.41
72 0.42
73 0.46
74 0.48
75 0.46
76 0.42
77 0.41
78 0.39
79 0.35
80 0.37
81 0.37
82 0.36
83 0.32
84 0.31
85 0.25
86 0.21
87 0.21
88 0.19
89 0.19
90 0.17
91 0.23
92 0.25
93 0.29
94 0.28
95 0.31
96 0.34
97 0.35
98 0.36
99 0.36
100 0.35
101 0.34
102 0.39
103 0.39
104 0.38
105 0.38
106 0.36
107 0.35
108 0.36
109 0.34
110 0.38
111 0.38
112 0.37
113 0.35
114 0.37
115 0.34
116 0.35
117 0.34
118 0.26
119 0.22
120 0.19
121 0.17
122 0.14
123 0.12
124 0.09
125 0.07
126 0.07
127 0.07
128 0.06
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.07
137 0.09
138 0.09
139 0.14
140 0.14
141 0.14
142 0.14
143 0.14
144 0.15
145 0.16
146 0.15
147 0.13
148 0.17
149 0.17
150 0.17
151 0.16
152 0.14
153 0.12
154 0.11
155 0.08
156 0.03
157 0.03
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.03
167 0.03
168 0.03
169 0.04
170 0.04
171 0.05
172 0.06
173 0.08
174 0.09
175 0.1
176 0.1
177 0.11
178 0.12
179 0.12
180 0.14
181 0.15
182 0.14
183 0.13
184 0.13
185 0.13
186 0.14
187 0.15
188 0.18
189 0.21
190 0.23
191 0.3
192 0.34
193 0.35
194 0.36
195 0.36
196 0.34
197 0.38
198 0.39
199 0.38
200 0.4
201 0.44
202 0.46
203 0.46
204 0.44
205 0.4
206 0.39
207 0.41
208 0.42
209 0.43
210 0.49
211 0.53
212 0.53
213 0.51
214 0.51
215 0.46
216 0.4
217 0.36
218 0.27
219 0.23
220 0.22
221 0.19
222 0.18
223 0.18
224 0.19
225 0.24
226 0.29
227 0.38
228 0.46
229 0.56
230 0.65
231 0.71
232 0.78
233 0.82
234 0.87
235 0.83
236 0.79
237 0.74
238 0.72
239 0.66
240 0.57
241 0.53
242 0.42
243 0.38
244 0.33
245 0.29
246 0.22
247 0.19
248 0.21
249 0.17
250 0.18
251 0.19
252 0.21
253 0.2
254 0.19
255 0.19
256 0.2
257 0.19
258 0.2
259 0.18
260 0.17
261 0.18
262 0.18
263 0.18
264 0.16
265 0.16
266 0.16
267 0.17
268 0.19
269 0.23
270 0.24
271 0.26
272 0.3
273 0.29
274 0.28
275 0.26
276 0.23
277 0.18
278 0.19
279 0.17
280 0.15
281 0.15
282 0.14
283 0.14
284 0.15
285 0.15
286 0.15
287 0.16
288 0.16
289 0.16
290 0.19
291 0.25
292 0.25
293 0.26
294 0.25
295 0.26
296 0.26
297 0.26
298 0.24
299 0.21
300 0.24
301 0.25
302 0.26
303 0.27
304 0.24
305 0.24
306 0.25
307 0.28
308 0.32
309 0.32
310 0.32
311 0.32
312 0.33
313 0.36
314 0.34