Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PZU0

Protein Details
Accession A0A1J9PZU0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSKPPPPKKRRTITILHPDLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027054  ALG2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0004378  F:GDP-Man:Man1GlcNAc2-PP-Dol alpha-1,3-mannosyltransferase activity  
GO:0102704  F:GDP-Man:Man2GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase activity  
GO:0006486  P:protein glycosylation  
Amino Acid Sequences MSKPPPPKKRRTITILHPDLGIGGAERLILDVALSLQARGHRVKIYTSHRDLNHCFEEARDGTLDVTVRGNTVFPDQIAGRFRVLFAVLRQVHLVVGLLMTRREQEQTDNQAKSEGEGEEEDLYIVDQVPACVPILKTFAPLLSSSSQSLQGNTKSKLKRKQRILFYCHFPDQLLARRDEGGVIRRLAKACYRYPFDWFEGWAISAADKVVANSNFTCGIVKQVFGEGLGDVKVVYPCVDTGNKKEGDRVEGGALWGGKKILLSINRFERKKDVGLAIRAYHGLGEERRKGTRLVIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.7
4 0.6
5 0.5
6 0.43
7 0.35
8 0.24
9 0.13
10 0.07
11 0.06
12 0.06
13 0.06
14 0.06
15 0.05
16 0.05
17 0.04
18 0.04
19 0.05
20 0.07
21 0.08
22 0.07
23 0.09
24 0.12
25 0.16
26 0.17
27 0.2
28 0.21
29 0.22
30 0.26
31 0.33
32 0.39
33 0.45
34 0.49
35 0.53
36 0.53
37 0.59
38 0.59
39 0.57
40 0.51
41 0.43
42 0.38
43 0.3
44 0.34
45 0.27
46 0.26
47 0.19
48 0.17
49 0.16
50 0.17
51 0.17
52 0.11
53 0.12
54 0.1
55 0.1
56 0.1
57 0.1
58 0.09
59 0.11
60 0.11
61 0.09
62 0.12
63 0.12
64 0.16
65 0.18
66 0.19
67 0.18
68 0.17
69 0.17
70 0.15
71 0.16
72 0.13
73 0.11
74 0.19
75 0.18
76 0.19
77 0.19
78 0.18
79 0.17
80 0.16
81 0.15
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.07
89 0.08
90 0.09
91 0.1
92 0.14
93 0.2
94 0.28
95 0.35
96 0.35
97 0.34
98 0.35
99 0.34
100 0.3
101 0.25
102 0.17
103 0.11
104 0.1
105 0.11
106 0.1
107 0.1
108 0.09
109 0.06
110 0.06
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.06
120 0.06
121 0.07
122 0.1
123 0.1
124 0.11
125 0.1
126 0.11
127 0.1
128 0.1
129 0.12
130 0.1
131 0.11
132 0.11
133 0.12
134 0.15
135 0.14
136 0.15
137 0.14
138 0.18
139 0.21
140 0.23
141 0.3
142 0.32
143 0.39
144 0.48
145 0.56
146 0.6
147 0.66
148 0.73
149 0.75
150 0.79
151 0.78
152 0.74
153 0.7
154 0.66
155 0.57
156 0.49
157 0.38
158 0.31
159 0.27
160 0.29
161 0.26
162 0.22
163 0.21
164 0.22
165 0.22
166 0.21
167 0.2
168 0.17
169 0.17
170 0.17
171 0.18
172 0.2
173 0.21
174 0.21
175 0.23
176 0.24
177 0.26
178 0.31
179 0.34
180 0.33
181 0.36
182 0.39
183 0.37
184 0.33
185 0.29
186 0.25
187 0.2
188 0.19
189 0.15
190 0.11
191 0.08
192 0.08
193 0.07
194 0.06
195 0.06
196 0.06
197 0.11
198 0.12
199 0.14
200 0.14
201 0.16
202 0.15
203 0.15
204 0.16
205 0.1
206 0.16
207 0.14
208 0.14
209 0.13
210 0.14
211 0.14
212 0.13
213 0.14
214 0.07
215 0.08
216 0.07
217 0.07
218 0.05
219 0.07
220 0.07
221 0.07
222 0.07
223 0.07
224 0.07
225 0.11
226 0.17
227 0.18
228 0.23
229 0.31
230 0.34
231 0.34
232 0.38
233 0.37
234 0.37
235 0.36
236 0.33
237 0.27
238 0.24
239 0.24
240 0.22
241 0.2
242 0.15
243 0.14
244 0.12
245 0.1
246 0.1
247 0.11
248 0.14
249 0.2
250 0.24
251 0.3
252 0.41
253 0.5
254 0.51
255 0.52
256 0.52
257 0.51
258 0.52
259 0.5
260 0.48
261 0.46
262 0.51
263 0.52
264 0.47
265 0.44
266 0.4
267 0.34
268 0.26
269 0.2
270 0.2
271 0.21
272 0.27
273 0.33
274 0.37
275 0.4
276 0.41
277 0.41