Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9PIA5

Protein Details
Accession A0A1J9PIA5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPSQSREKRRKKRGKRKHEKEEEEMEWBasic
NLS Segment(s)
PositionSequence
7-21REKRRKKRGKRKHEK
Subcellular Location(s) nucl 11, cyto 9.5, cyto_mito 8.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MAPSQSREKRRKKRGKRKHEKEEEEMEWERERERPQKTVTSGQQLKRQRWCPPCPGSGGSGSGTIGLGLPTAVGAEAAWVVAASGGDGRPKLFAFRKTAPKALPTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.96
3 0.97
4 0.97
5 0.97
6 0.96
7 0.92
8 0.88
9 0.85
10 0.75
11 0.7
12 0.61
13 0.52
14 0.43
15 0.36
16 0.29
17 0.25
18 0.28
19 0.29
20 0.31
21 0.33
22 0.35
23 0.41
24 0.44
25 0.48
26 0.46
27 0.49
28 0.52
29 0.5
30 0.55
31 0.55
32 0.56
33 0.56
34 0.57
35 0.56
36 0.57
37 0.58
38 0.58
39 0.56
40 0.52
41 0.47
42 0.44
43 0.37
44 0.3
45 0.27
46 0.2
47 0.16
48 0.14
49 0.11
50 0.09
51 0.07
52 0.06
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.02
61 0.02
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.05
73 0.07
74 0.08
75 0.08
76 0.1
77 0.11
78 0.17
79 0.22
80 0.27
81 0.33
82 0.41
83 0.51
84 0.55
85 0.61
86 0.58