Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B9X6

Protein Details
Accession G3B9X6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
279-304SFYIDVYKKKTTRRSKRVKSVSGGVAHydrophilic
NLS Segment(s)
PositionSequence
291-293RRS
Subcellular Location(s) cyto 10, plas 9, mito 3, extr 2, E.R. 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR030457  ELO_CS  
IPR002076  ELO_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0006633  P:fatty acid biosynthetic process  
KEGG cten:CANTEDRAFT_109600  -  
Pfam View protein in Pfam  
PF01151  ELO  
PROSITE View protein in PROSITE  
PS01188  ELO  
Amino Acid Sequences MSYSFPFPTPDTPFGVKLFPYFDWLVSKITGGELVPSKFEFIAGEVPLSTGKPVLAAIATYYLVIFGGDFIFKKFKITPFVLNGPFQVHNVILTTASSTLLVLMVEQIFPMIYYEGLYYAICSAKAWTQELEVLYYFNYIFKFVEFVDTLFLVIKQKRLTFLHTYHHGATALLCYTQLTGKTAISWVPITLNLWVHVVMYFYYFLAARGIRVWWKEWVTRFQILQFILDLGFVYFATYNKIVDEFLGGSLPYCGSCTGEMSAAYMGCGILSSYLVLFISFYIDVYKKKTTRRSKRVKSVSGGVAAQVNEYVHTSARDATPVPESKVRSRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.32
4 0.27
5 0.28
6 0.22
7 0.25
8 0.23
9 0.23
10 0.24
11 0.25
12 0.25
13 0.22
14 0.22
15 0.17
16 0.16
17 0.16
18 0.12
19 0.14
20 0.17
21 0.17
22 0.18
23 0.18
24 0.19
25 0.18
26 0.18
27 0.14
28 0.12
29 0.15
30 0.14
31 0.14
32 0.12
33 0.13
34 0.13
35 0.13
36 0.11
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.06
44 0.07
45 0.08
46 0.08
47 0.08
48 0.07
49 0.06
50 0.06
51 0.06
52 0.05
53 0.04
54 0.05
55 0.06
56 0.06
57 0.08
58 0.12
59 0.12
60 0.15
61 0.19
62 0.22
63 0.28
64 0.31
65 0.35
66 0.37
67 0.44
68 0.43
69 0.4
70 0.38
71 0.34
72 0.32
73 0.26
74 0.22
75 0.15
76 0.13
77 0.13
78 0.12
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.07
85 0.06
86 0.05
87 0.06
88 0.05
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.05
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.07
110 0.07
111 0.09
112 0.11
113 0.12
114 0.11
115 0.11
116 0.14
117 0.14
118 0.14
119 0.12
120 0.1
121 0.09
122 0.1
123 0.09
124 0.08
125 0.08
126 0.07
127 0.07
128 0.07
129 0.08
130 0.07
131 0.1
132 0.09
133 0.09
134 0.09
135 0.09
136 0.09
137 0.08
138 0.09
139 0.09
140 0.1
141 0.13
142 0.14
143 0.14
144 0.18
145 0.19
146 0.24
147 0.25
148 0.27
149 0.29
150 0.31
151 0.33
152 0.3
153 0.3
154 0.25
155 0.2
156 0.17
157 0.13
158 0.1
159 0.07
160 0.06
161 0.05
162 0.05
163 0.07
164 0.07
165 0.07
166 0.08
167 0.08
168 0.09
169 0.09
170 0.09
171 0.09
172 0.09
173 0.08
174 0.07
175 0.07
176 0.08
177 0.09
178 0.09
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.06
186 0.06
187 0.06
188 0.05
189 0.06
190 0.06
191 0.06
192 0.08
193 0.08
194 0.07
195 0.08
196 0.09
197 0.12
198 0.13
199 0.14
200 0.17
201 0.2
202 0.23
203 0.26
204 0.31
205 0.33
206 0.34
207 0.33
208 0.3
209 0.32
210 0.28
211 0.25
212 0.19
213 0.15
214 0.12
215 0.11
216 0.1
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.06
223 0.09
224 0.1
225 0.1
226 0.1
227 0.11
228 0.1
229 0.09
230 0.11
231 0.08
232 0.08
233 0.08
234 0.08
235 0.07
236 0.08
237 0.08
238 0.06
239 0.06
240 0.06
241 0.07
242 0.08
243 0.09
244 0.1
245 0.11
246 0.11
247 0.11
248 0.12
249 0.1
250 0.1
251 0.08
252 0.07
253 0.06
254 0.06
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04
260 0.05
261 0.05
262 0.05
263 0.05
264 0.05
265 0.07
266 0.07
267 0.07
268 0.1
269 0.13
270 0.15
271 0.2
272 0.28
273 0.3
274 0.39
275 0.5
276 0.57
277 0.67
278 0.76
279 0.82
280 0.85
281 0.91
282 0.93
283 0.91
284 0.86
285 0.82
286 0.76
287 0.69
288 0.58
289 0.48
290 0.41
291 0.33
292 0.27
293 0.2
294 0.16
295 0.12
296 0.13
297 0.13
298 0.11
299 0.12
300 0.13
301 0.15
302 0.16
303 0.18
304 0.17
305 0.19
306 0.25
307 0.28
308 0.32
309 0.35
310 0.39
311 0.46