Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PYZ3

Protein Details
Accession A0A1J9PYZ3   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
242-282QREREREERYERRRREREKEREEERKRDRERDRDRDRGRDRBasic
288-308LEPSPRPSRQRSRTPKEPTPEHydrophilic
NLS Segment(s)
PositionSequence
201-300RKQRELEKQREEEDRKKQQELEEKRRAEREKIREERRLLEEQREREREERYERRRREREKEREEERKRDRERDRDRDRGRDRDRDAMLEPSPRPSRQRSR
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 12.333
Family & Domain DBs
Pfam View protein in Pfam  
PF05205  COMPASS-Shg1  
Amino Acid Sequences MASPGVEAAGVKRPSVDLETLQRKKFKTSDLPLSAAQRSSIDGLLYAFKKKGGFDSVRKKIWAEFSESEAKNSLTSSLIEMAESEIDRDPSLLSRERGKAATLIEGAVDRSDLYKSVEGAIDAISSNHLDYILDSLRTIRRQEVGEEMAALEEEKGSRTDDHYEREVKIKRQEREITWLKELEKQKQLEIEEAKSKAEELRKQRELEKQREEEDRKKQQELEEKRRAEREKIREERRLLEEQREREREERYERRRREREKEREEERKRDRERDRDRDRGRDRDRDAMLEPSPRPSRQRSRTPKEPTPEPVDEKSLEDAALELLLKEGKELAEKSRQKPEFDFEQAEALENEQLQQPQPQPQPQQRSRQPSVTDTKAPRTDQTRLRTIHSRLNKEVSPPSDPPKSSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.26
4 0.22
5 0.31
6 0.42
7 0.48
8 0.53
9 0.56
10 0.54
11 0.59
12 0.58
13 0.57
14 0.57
15 0.59
16 0.64
17 0.63
18 0.65
19 0.61
20 0.62
21 0.55
22 0.45
23 0.38
24 0.27
25 0.24
26 0.22
27 0.2
28 0.15
29 0.13
30 0.13
31 0.18
32 0.19
33 0.2
34 0.19
35 0.2
36 0.22
37 0.22
38 0.26
39 0.28
40 0.34
41 0.41
42 0.52
43 0.58
44 0.61
45 0.61
46 0.57
47 0.53
48 0.55
49 0.47
50 0.45
51 0.38
52 0.39
53 0.48
54 0.47
55 0.43
56 0.36
57 0.34
58 0.26
59 0.25
60 0.2
61 0.12
62 0.12
63 0.13
64 0.14
65 0.14
66 0.13
67 0.13
68 0.13
69 0.13
70 0.12
71 0.12
72 0.1
73 0.1
74 0.11
75 0.11
76 0.1
77 0.11
78 0.15
79 0.18
80 0.19
81 0.25
82 0.28
83 0.31
84 0.31
85 0.3
86 0.28
87 0.25
88 0.26
89 0.2
90 0.17
91 0.14
92 0.14
93 0.13
94 0.1
95 0.09
96 0.06
97 0.06
98 0.07
99 0.07
100 0.1
101 0.11
102 0.11
103 0.13
104 0.13
105 0.12
106 0.12
107 0.11
108 0.09
109 0.08
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.09
119 0.09
120 0.09
121 0.09
122 0.12
123 0.16
124 0.18
125 0.2
126 0.18
127 0.2
128 0.21
129 0.23
130 0.24
131 0.23
132 0.2
133 0.19
134 0.16
135 0.13
136 0.12
137 0.1
138 0.06
139 0.04
140 0.04
141 0.05
142 0.06
143 0.07
144 0.08
145 0.1
146 0.16
147 0.19
148 0.22
149 0.26
150 0.28
151 0.28
152 0.35
153 0.38
154 0.36
155 0.42
156 0.46
157 0.45
158 0.5
159 0.54
160 0.48
161 0.53
162 0.56
163 0.5
164 0.45
165 0.45
166 0.38
167 0.4
168 0.41
169 0.39
170 0.37
171 0.34
172 0.33
173 0.34
174 0.34
175 0.32
176 0.31
177 0.27
178 0.25
179 0.24
180 0.23
181 0.2
182 0.19
183 0.18
184 0.2
185 0.24
186 0.27
187 0.35
188 0.4
189 0.41
190 0.46
191 0.51
192 0.54
193 0.56
194 0.56
195 0.51
196 0.5
197 0.57
198 0.58
199 0.57
200 0.58
201 0.6
202 0.55
203 0.55
204 0.53
205 0.5
206 0.54
207 0.56
208 0.57
209 0.56
210 0.55
211 0.56
212 0.6
213 0.58
214 0.55
215 0.54
216 0.53
217 0.55
218 0.62
219 0.66
220 0.66
221 0.66
222 0.64
223 0.6
224 0.58
225 0.5
226 0.5
227 0.49
228 0.48
229 0.54
230 0.51
231 0.49
232 0.44
233 0.46
234 0.43
235 0.46
236 0.51
237 0.52
238 0.6
239 0.65
240 0.73
241 0.79
242 0.82
243 0.83
244 0.84
245 0.85
246 0.84
247 0.85
248 0.83
249 0.84
250 0.82
251 0.82
252 0.8
253 0.79
254 0.75
255 0.75
256 0.75
257 0.75
258 0.79
259 0.79
260 0.79
261 0.79
262 0.79
263 0.8
264 0.79
265 0.79
266 0.75
267 0.73
268 0.68
269 0.66
270 0.62
271 0.54
272 0.49
273 0.43
274 0.38
275 0.35
276 0.32
277 0.31
278 0.33
279 0.33
280 0.36
281 0.4
282 0.49
283 0.52
284 0.63
285 0.66
286 0.72
287 0.8
288 0.84
289 0.83
290 0.79
291 0.76
292 0.71
293 0.69
294 0.65
295 0.6
296 0.53
297 0.49
298 0.44
299 0.39
300 0.35
301 0.28
302 0.22
303 0.16
304 0.14
305 0.1
306 0.1
307 0.08
308 0.05
309 0.05
310 0.07
311 0.07
312 0.06
313 0.07
314 0.07
315 0.11
316 0.13
317 0.17
318 0.27
319 0.34
320 0.39
321 0.48
322 0.51
323 0.51
324 0.53
325 0.54
326 0.51
327 0.5
328 0.49
329 0.39
330 0.39
331 0.35
332 0.34
333 0.27
334 0.21
335 0.17
336 0.13
337 0.14
338 0.13
339 0.14
340 0.14
341 0.19
342 0.21
343 0.28
344 0.35
345 0.41
346 0.48
347 0.56
348 0.66
349 0.68
350 0.76
351 0.76
352 0.79
353 0.78
354 0.76
355 0.71
356 0.69
357 0.69
358 0.65
359 0.65
360 0.6
361 0.64
362 0.62
363 0.61
364 0.59
365 0.57
366 0.59
367 0.58
368 0.6
369 0.6
370 0.56
371 0.6
372 0.62
373 0.6
374 0.62
375 0.63
376 0.64
377 0.61
378 0.65
379 0.61
380 0.58
381 0.62
382 0.57
383 0.54
384 0.51
385 0.52
386 0.54
387 0.53