Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9P4I8

Protein Details
Accession A0A1J9P4I8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-28KLIVNEKKLSREKRLREPMYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 4, cyto 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021842  DUF3435  
Pfam View protein in Pfam  
PF11917  DUF3435  
Amino Acid Sequences MIQAQNVIKLIVNEKKLSREKRLREPMYVDDLAKYLRVLLIMNEMKHHKQSARCLDSASVSESKAHTDLELSLQCILSMRRADRSLYQDLSRHEEHIIYDSTLMLSLHVFLLKILFYIQTFKSSSIRRLKNLYSLSVLNELNQQKLLLQNNLTNLFIFYFTVCKEDDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.47
4 0.52
5 0.57
6 0.6
7 0.65
8 0.72
9 0.8
10 0.76
11 0.72
12 0.7
13 0.64
14 0.62
15 0.56
16 0.45
17 0.35
18 0.32
19 0.27
20 0.22
21 0.17
22 0.1
23 0.08
24 0.08
25 0.08
26 0.07
27 0.15
28 0.18
29 0.18
30 0.21
31 0.24
32 0.25
33 0.27
34 0.29
35 0.25
36 0.28
37 0.37
38 0.44
39 0.45
40 0.44
41 0.43
42 0.41
43 0.38
44 0.34
45 0.28
46 0.19
47 0.15
48 0.16
49 0.15
50 0.15
51 0.14
52 0.13
53 0.09
54 0.09
55 0.09
56 0.11
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.1
63 0.1
64 0.09
65 0.11
66 0.11
67 0.14
68 0.15
69 0.16
70 0.19
71 0.24
72 0.24
73 0.24
74 0.24
75 0.24
76 0.25
77 0.29
78 0.26
79 0.22
80 0.19
81 0.18
82 0.17
83 0.16
84 0.16
85 0.1
86 0.1
87 0.09
88 0.08
89 0.08
90 0.08
91 0.05
92 0.04
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.09
105 0.1
106 0.13
107 0.14
108 0.16
109 0.21
110 0.23
111 0.32
112 0.38
113 0.43
114 0.43
115 0.48
116 0.49
117 0.51
118 0.51
119 0.45
120 0.38
121 0.35
122 0.33
123 0.32
124 0.29
125 0.22
126 0.26
127 0.25
128 0.23
129 0.23
130 0.2
131 0.17
132 0.23
133 0.26
134 0.23
135 0.25
136 0.26
137 0.31
138 0.33
139 0.32
140 0.27
141 0.23
142 0.2
143 0.18
144 0.16
145 0.11
146 0.12
147 0.12
148 0.14