Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PDJ9

Protein Details
Accession A0A1J9PDJ9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
17-47QTPKVEPQEKKKTPKGRAKKRLQHTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
14-40VKSQTPKVEPQEKKKTPKGRAKKRLQH
Subcellular Location(s) mito 11.5, mito_nucl 10, cyto 8, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRLQHTRRFVNVTMTGGKRKVRFLHPTCIPEWRWATSRARADIKCEEKTWNNRELF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.49
5 0.51
6 0.6
7 0.63
8 0.68
9 0.68
10 0.7
11 0.73
12 0.75
13 0.78
14 0.77
15 0.78
16 0.78
17 0.82
18 0.83
19 0.83
20 0.86
21 0.88
22 0.89
23 0.9
24 0.91
25 0.89
26 0.88
27 0.84
28 0.82
29 0.77
30 0.72
31 0.62
32 0.56
33 0.48
34 0.4
35 0.36
36 0.29
37 0.25
38 0.24
39 0.27
40 0.24
41 0.27
42 0.29
43 0.32
44 0.4
45 0.42
46 0.49
47 0.51
48 0.52
49 0.49
50 0.51
51 0.45
52 0.42
53 0.4
54 0.35
55 0.32
56 0.34
57 0.38
58 0.4
59 0.45
60 0.44
61 0.49
62 0.46
63 0.49
64 0.54
65 0.55
66 0.51
67 0.47
68 0.48
69 0.49
70 0.58
71 0.58