Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QQ74

Protein Details
Accession A0A1J9QQ74   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTPPPRRPRRKLSWWRRKYYIWRSKEHydrophilic
NLS Segment(s)
PositionSequence
5-18PRRPRRKLSWWRRK
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MTPPPRRPRRKLSWWRRKYYIWRSKESPLQIRGSLIRLRHQNKRPFLALLRLFLPSSLTTWSYPVPEPLPPLRLVDNPSLCWTRRCEGDLKNLQAIPLWRSHDTPLRSLYRMYEATMAGDSMIVAIGYEVEYFWYRGERAWELERIPDPKDPDPIRYAILACLVDSMPEAFNFKLSIGMRRDRENVEPKDWDGVNNPYAPYTPVTGPEWTKNVPPVDKEYLREVMPERMLDSNGMLVLHEEAESEIFAKRNIVASEERFWRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.87
4 0.86
5 0.85
6 0.85
7 0.84
8 0.8
9 0.78
10 0.74
11 0.74
12 0.73
13 0.71
14 0.68
15 0.64
16 0.61
17 0.54
18 0.52
19 0.47
20 0.44
21 0.39
22 0.33
23 0.34
24 0.39
25 0.44
26 0.5
27 0.58
28 0.62
29 0.66
30 0.69
31 0.65
32 0.6
33 0.57
34 0.57
35 0.5
36 0.43
37 0.37
38 0.32
39 0.3
40 0.25
41 0.24
42 0.15
43 0.14
44 0.13
45 0.14
46 0.13
47 0.15
48 0.16
49 0.17
50 0.17
51 0.18
52 0.17
53 0.17
54 0.21
55 0.22
56 0.24
57 0.22
58 0.23
59 0.23
60 0.24
61 0.26
62 0.28
63 0.27
64 0.26
65 0.29
66 0.3
67 0.29
68 0.29
69 0.29
70 0.25
71 0.26
72 0.27
73 0.28
74 0.29
75 0.39
76 0.43
77 0.42
78 0.43
79 0.4
80 0.38
81 0.34
82 0.32
83 0.23
84 0.2
85 0.2
86 0.18
87 0.19
88 0.22
89 0.26
90 0.27
91 0.27
92 0.29
93 0.29
94 0.28
95 0.28
96 0.26
97 0.24
98 0.23
99 0.21
100 0.18
101 0.15
102 0.14
103 0.14
104 0.12
105 0.08
106 0.07
107 0.06
108 0.03
109 0.03
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.03
118 0.04
119 0.05
120 0.05
121 0.06
122 0.06
123 0.07
124 0.1
125 0.1
126 0.13
127 0.14
128 0.16
129 0.16
130 0.18
131 0.2
132 0.19
133 0.2
134 0.2
135 0.22
136 0.22
137 0.29
138 0.28
139 0.28
140 0.29
141 0.28
142 0.26
143 0.23
144 0.22
145 0.14
146 0.16
147 0.13
148 0.1
149 0.1
150 0.09
151 0.08
152 0.08
153 0.08
154 0.06
155 0.06
156 0.08
157 0.07
158 0.08
159 0.08
160 0.08
161 0.12
162 0.13
163 0.19
164 0.22
165 0.28
166 0.3
167 0.33
168 0.36
169 0.34
170 0.41
171 0.44
172 0.44
173 0.42
174 0.42
175 0.39
176 0.41
177 0.38
178 0.32
179 0.26
180 0.26
181 0.24
182 0.24
183 0.23
184 0.19
185 0.19
186 0.19
187 0.17
188 0.16
189 0.14
190 0.15
191 0.18
192 0.2
193 0.23
194 0.25
195 0.28
196 0.26
197 0.28
198 0.3
199 0.32
200 0.32
201 0.32
202 0.35
203 0.4
204 0.41
205 0.41
206 0.4
207 0.39
208 0.36
209 0.36
210 0.32
211 0.3
212 0.29
213 0.27
214 0.24
215 0.23
216 0.24
217 0.21
218 0.19
219 0.14
220 0.13
221 0.12
222 0.1
223 0.09
224 0.09
225 0.09
226 0.08
227 0.07
228 0.07
229 0.08
230 0.08
231 0.08
232 0.09
233 0.09
234 0.1
235 0.11
236 0.12
237 0.17
238 0.17
239 0.2
240 0.24
241 0.28
242 0.34