Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9QA84

Protein Details
Accession A0A1J9QA84    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
170-191VLLWWWRKRKARKIAEEERKQEHydrophilic
NLS Segment(s)
PositionSequence
176-182RKRKARK
Subcellular Location(s) nucl 12.5, cyto_nucl 8, mito 4, plas 4, cyto 2.5, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MATEGNPPAPTTDNPAPPASGPSDPTVPTVPPQPSTSPTAVPPPQTTTPPPPPPPPPTTQPDPNPPPSSRSTSSTPRVDPPPPNTPQPPPPPPQSRTTPPGSNTTVYITSTASNPPPPATQSPDATTSGLPSVLPHPSTGNSGSGGLSAAGTIAVAVVVPVASVALIILVLLWWWRKRKARKIAEEERKQEIEEYRFNPNHDPLLPAVGLPGNFDDGAGMKDGNGGGYRGWGTTTSTSRKLSTNLSSGAGGITASDAGSNPGPPRPVSPVDDSIPYEDDNRPISGDYSGLDPAAAAMLSHPNGNNNTNARDIHRGPSNASSAYSNANRSDLSDDIPMPGVLPGTAQYYDDPYYTDGTPQTGGPFVDNAYGAPPVIRDVQARRNTRIENPSVFPQQGNAGIAQNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.38
4 0.35
5 0.38
6 0.33
7 0.28
8 0.25
9 0.25
10 0.27
11 0.27
12 0.29
13 0.27
14 0.25
15 0.24
16 0.29
17 0.28
18 0.28
19 0.31
20 0.31
21 0.33
22 0.37
23 0.38
24 0.33
25 0.32
26 0.38
27 0.38
28 0.38
29 0.38
30 0.38
31 0.39
32 0.41
33 0.45
34 0.45
35 0.51
36 0.56
37 0.58
38 0.58
39 0.63
40 0.66
41 0.66
42 0.63
43 0.6
44 0.58
45 0.61
46 0.63
47 0.62
48 0.65
49 0.66
50 0.68
51 0.67
52 0.61
53 0.59
54 0.55
55 0.56
56 0.49
57 0.47
58 0.45
59 0.47
60 0.54
61 0.55
62 0.53
63 0.51
64 0.53
65 0.55
66 0.56
67 0.54
68 0.55
69 0.52
70 0.56
71 0.54
72 0.54
73 0.57
74 0.59
75 0.6
76 0.56
77 0.62
78 0.64
79 0.63
80 0.64
81 0.62
82 0.59
83 0.58
84 0.59
85 0.55
86 0.48
87 0.52
88 0.49
89 0.43
90 0.37
91 0.35
92 0.29
93 0.24
94 0.23
95 0.17
96 0.14
97 0.15
98 0.16
99 0.15
100 0.16
101 0.17
102 0.17
103 0.18
104 0.21
105 0.23
106 0.27
107 0.28
108 0.28
109 0.3
110 0.31
111 0.31
112 0.28
113 0.24
114 0.19
115 0.16
116 0.14
117 0.11
118 0.09
119 0.1
120 0.12
121 0.12
122 0.11
123 0.12
124 0.13
125 0.16
126 0.16
127 0.15
128 0.13
129 0.13
130 0.12
131 0.11
132 0.1
133 0.08
134 0.06
135 0.05
136 0.04
137 0.03
138 0.03
139 0.03
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.03
159 0.05
160 0.08
161 0.11
162 0.18
163 0.26
164 0.35
165 0.46
166 0.56
167 0.64
168 0.71
169 0.78
170 0.82
171 0.85
172 0.84
173 0.78
174 0.72
175 0.62
176 0.52
177 0.46
178 0.39
179 0.32
180 0.29
181 0.28
182 0.3
183 0.31
184 0.32
185 0.32
186 0.29
187 0.27
188 0.22
189 0.21
190 0.14
191 0.15
192 0.14
193 0.11
194 0.1
195 0.09
196 0.08
197 0.07
198 0.07
199 0.06
200 0.06
201 0.06
202 0.05
203 0.05
204 0.05
205 0.06
206 0.05
207 0.04
208 0.05
209 0.05
210 0.06
211 0.05
212 0.05
213 0.05
214 0.06
215 0.07
216 0.06
217 0.06
218 0.06
219 0.08
220 0.11
221 0.16
222 0.19
223 0.22
224 0.24
225 0.25
226 0.26
227 0.27
228 0.28
229 0.27
230 0.26
231 0.24
232 0.24
233 0.22
234 0.2
235 0.18
236 0.13
237 0.09
238 0.06
239 0.04
240 0.04
241 0.03
242 0.03
243 0.03
244 0.05
245 0.06
246 0.07
247 0.08
248 0.1
249 0.11
250 0.12
251 0.14
252 0.18
253 0.21
254 0.24
255 0.27
256 0.29
257 0.29
258 0.31
259 0.3
260 0.26
261 0.24
262 0.21
263 0.19
264 0.17
265 0.18
266 0.17
267 0.17
268 0.16
269 0.15
270 0.15
271 0.13
272 0.12
273 0.1
274 0.1
275 0.1
276 0.09
277 0.08
278 0.07
279 0.06
280 0.06
281 0.06
282 0.03
283 0.04
284 0.07
285 0.08
286 0.09
287 0.1
288 0.13
289 0.16
290 0.18
291 0.22
292 0.22
293 0.24
294 0.26
295 0.27
296 0.27
297 0.31
298 0.31
299 0.32
300 0.35
301 0.34
302 0.33
303 0.36
304 0.36
305 0.3
306 0.29
307 0.25
308 0.2
309 0.25
310 0.25
311 0.24
312 0.22
313 0.23
314 0.21
315 0.22
316 0.24
317 0.19
318 0.19
319 0.19
320 0.18
321 0.18
322 0.19
323 0.17
324 0.14
325 0.13
326 0.11
327 0.08
328 0.08
329 0.07
330 0.09
331 0.1
332 0.1
333 0.11
334 0.14
335 0.16
336 0.16
337 0.16
338 0.15
339 0.17
340 0.17
341 0.19
342 0.16
343 0.17
344 0.17
345 0.17
346 0.17
347 0.16
348 0.16
349 0.15
350 0.15
351 0.13
352 0.15
353 0.14
354 0.13
355 0.12
356 0.12
357 0.11
358 0.1
359 0.1
360 0.1
361 0.13
362 0.15
363 0.18
364 0.24
365 0.34
366 0.43
367 0.48
368 0.51
369 0.56
370 0.58
371 0.62
372 0.64
373 0.61
374 0.58
375 0.57
376 0.59
377 0.57
378 0.54
379 0.46
380 0.39
381 0.36
382 0.34
383 0.3
384 0.25