Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QB36

Protein Details
Accession A0A1J9QB36   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-115SKGDDKPKPKDPKPKPKPKDPKPKPKPKKTVGQKVLDBasic
NLS Segment(s)
PositionSequence
84-108KPKPKDPKPKPKPKDPKPKPKPKKT
Subcellular Location(s) mito_nucl 10.333, nucl 10, mito 9.5, cyto_nucl 7.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
Amino Acid Sequences MDGVGKCMARSKCDGVYYDGACGKNSGETRCCVQVKCKVGGKSGLCQNTKRTSCKGGKFHAGSSSTCPAGNDVQCCIPSKGDDKPKPKDPKPKPKPKDPKPKPKPKKTVGQKVLDVAMKEKGTKYVWGGGSCKGPTGGGYDCSGLVGYAVCKVTKRNLFKEGLRVTYTMYCASSSKLGKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.42
4 0.38
5 0.37
6 0.37
7 0.32
8 0.29
9 0.28
10 0.22
11 0.22
12 0.25
13 0.25
14 0.24
15 0.26
16 0.29
17 0.36
18 0.38
19 0.34
20 0.37
21 0.4
22 0.43
23 0.47
24 0.5
25 0.45
26 0.45
27 0.51
28 0.47
29 0.46
30 0.47
31 0.48
32 0.44
33 0.44
34 0.47
35 0.49
36 0.52
37 0.49
38 0.46
39 0.47
40 0.53
41 0.59
42 0.59
43 0.54
44 0.58
45 0.56
46 0.53
47 0.5
48 0.45
49 0.37
50 0.35
51 0.33
52 0.25
53 0.23
54 0.21
55 0.17
56 0.19
57 0.2
58 0.16
59 0.15
60 0.16
61 0.17
62 0.19
63 0.18
64 0.14
65 0.14
66 0.15
67 0.21
68 0.3
69 0.36
70 0.41
71 0.46
72 0.55
73 0.62
74 0.66
75 0.71
76 0.71
77 0.75
78 0.79
79 0.84
80 0.81
81 0.83
82 0.87
83 0.87
84 0.88
85 0.87
86 0.88
87 0.87
88 0.93
89 0.93
90 0.92
91 0.92
92 0.86
93 0.87
94 0.86
95 0.86
96 0.82
97 0.77
98 0.68
99 0.59
100 0.56
101 0.47
102 0.37
103 0.27
104 0.24
105 0.18
106 0.18
107 0.17
108 0.17
109 0.16
110 0.18
111 0.18
112 0.21
113 0.23
114 0.25
115 0.26
116 0.25
117 0.28
118 0.27
119 0.25
120 0.19
121 0.16
122 0.14
123 0.16
124 0.15
125 0.13
126 0.14
127 0.14
128 0.13
129 0.14
130 0.13
131 0.09
132 0.08
133 0.06
134 0.06
135 0.08
136 0.1
137 0.1
138 0.11
139 0.14
140 0.22
141 0.31
142 0.38
143 0.41
144 0.47
145 0.52
146 0.54
147 0.61
148 0.58
149 0.54
150 0.48
151 0.43
152 0.39
153 0.37
154 0.36
155 0.28
156 0.24
157 0.2
158 0.19
159 0.22
160 0.25