Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PA63

Protein Details
Accession A0A1J9PA63    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-31STGPRDKRTHQSKLAKENDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
Amino Acid Sequences MPPKRRSAPSASTGPRDKRTHQSKLAKENDITGEEEAEIKEAFHLFSTKSDEHSSTKEGLIRTQDVRRALIALGLPPTDQKELTSILSAIDPASTGLTTYESFLSVCALKLRSRSEDAIDAEVEHAYKLFTRGSEGPISVDHLRKVARDLKEDVNEELLRDMVREANGGDGVRAGVSLEQFREVMVRAGVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.63
4 0.62
5 0.63
6 0.67
7 0.68
8 0.7
9 0.73
10 0.73
11 0.78
12 0.8
13 0.75
14 0.66
15 0.62
16 0.55
17 0.46
18 0.4
19 0.3
20 0.23
21 0.18
22 0.19
23 0.14
24 0.12
25 0.1
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.09
33 0.11
34 0.18
35 0.17
36 0.2
37 0.22
38 0.24
39 0.26
40 0.28
41 0.29
42 0.24
43 0.25
44 0.25
45 0.23
46 0.23
47 0.24
48 0.24
49 0.24
50 0.26
51 0.28
52 0.27
53 0.27
54 0.25
55 0.22
56 0.19
57 0.17
58 0.14
59 0.11
60 0.1
61 0.09
62 0.09
63 0.08
64 0.1
65 0.1
66 0.09
67 0.08
68 0.09
69 0.11
70 0.11
71 0.11
72 0.09
73 0.09
74 0.09
75 0.08
76 0.07
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.06
93 0.06
94 0.07
95 0.09
96 0.1
97 0.13
98 0.16
99 0.18
100 0.21
101 0.22
102 0.22
103 0.25
104 0.25
105 0.24
106 0.21
107 0.18
108 0.15
109 0.14
110 0.12
111 0.07
112 0.06
113 0.05
114 0.05
115 0.07
116 0.07
117 0.07
118 0.11
119 0.13
120 0.16
121 0.18
122 0.17
123 0.17
124 0.17
125 0.21
126 0.2
127 0.21
128 0.18
129 0.19
130 0.19
131 0.19
132 0.23
133 0.26
134 0.27
135 0.29
136 0.33
137 0.38
138 0.42
139 0.44
140 0.4
141 0.39
142 0.35
143 0.31
144 0.27
145 0.21
146 0.15
147 0.13
148 0.13
149 0.1
150 0.1
151 0.1
152 0.1
153 0.11
154 0.13
155 0.13
156 0.12
157 0.1
158 0.1
159 0.09
160 0.09
161 0.07
162 0.07
163 0.09
164 0.11
165 0.12
166 0.13
167 0.13
168 0.14
169 0.15
170 0.14
171 0.15