Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9NZH5

Protein Details
Accession A0A1J9NZH5    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-85MPSQKSFRTKQKLAKAQKQNRPIPQWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPASTAHRPPPTAKPCPTIPHDFLATLNPISKRVSSEPKNPHKNSRESAVNRNVPLTVRMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.58
4 0.59
5 0.56
6 0.51
7 0.46
8 0.43
9 0.38
10 0.34
11 0.3
12 0.26
13 0.19
14 0.2
15 0.16
16 0.16
17 0.17
18 0.17
19 0.18
20 0.21
21 0.3
22 0.31
23 0.4
24 0.49
25 0.57
26 0.67
27 0.66
28 0.7
29 0.67
30 0.68
31 0.61
32 0.56
33 0.55
34 0.48
35 0.53
36 0.52
37 0.49
38 0.43
39 0.41
40 0.37
41 0.28
42 0.27
43 0.21
44 0.15
45 0.14
46 0.18
47 0.2
48 0.23
49 0.28
50 0.32
51 0.37
52 0.42
53 0.49
54 0.55
55 0.59
56 0.65
57 0.7
58 0.74
59 0.77
60 0.8
61 0.82
62 0.83
63 0.85
64 0.86
65 0.84
66 0.82
67 0.79
68 0.78
69 0.74
70 0.73
71 0.74
72 0.69
73 0.67
74 0.63
75 0.6