Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9PGR3

Protein Details
Accession A0A1J9PGR3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-36DTPTVPRTPRTPRRQMPKVGNKGLQGHydrophilic
51-75YNESCSPSPAKKKGKKDIPERRLIIHydrophilic
NLS Segment(s)
PositionSequence
61-67KKKGKKD
Subcellular Location(s) cyto 14, cyto_nucl 10, mito 9, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
Amino Acid Sequences MSPVLPFGFNDTPTVPRTPRTPRRQMPKVGNKGLQGELTSPNIVKRENVGYNESCSPSPAKKKGKKDIPERRLIIGIDFGTTYSAGVAMAHSNAEPGDIEVIKEWPGNFEVRIKVPSTIADRINNSEFRQWGYEVTAGMPCSSWFKLKMAPSNTSAIQDDPLLLHSVGPSLLRVPDGETPRTLCEEYLSRLYKHVLEKIGREYTNAMVDTLRVDVVLTTPADWSRGYKIALVEAAHAAGVASRIGDSISTIDEPEAAALAAFETSRKLGNGSIFKVKTNVVVVDIGGGTICGATTIDRELHRLMESKYGNAFSSLQVKETGHGGKFMTKFESVKRRFKGHGIAYDKEYKLPLLMDVEDGTGYEGGLGEVTITREVAFQSLVDRSFGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.28
4 0.35
5 0.43
6 0.52
7 0.59
8 0.66
9 0.7
10 0.79
11 0.85
12 0.87
13 0.87
14 0.87
15 0.88
16 0.85
17 0.8
18 0.73
19 0.68
20 0.61
21 0.51
22 0.41
23 0.34
24 0.28
25 0.27
26 0.25
27 0.22
28 0.22
29 0.23
30 0.23
31 0.21
32 0.22
33 0.27
34 0.3
35 0.33
36 0.36
37 0.35
38 0.39
39 0.42
40 0.4
41 0.32
42 0.29
43 0.3
44 0.32
45 0.4
46 0.45
47 0.52
48 0.58
49 0.69
50 0.77
51 0.83
52 0.85
53 0.87
54 0.88
55 0.86
56 0.87
57 0.8
58 0.72
59 0.65
60 0.55
61 0.45
62 0.37
63 0.29
64 0.2
65 0.17
66 0.14
67 0.11
68 0.11
69 0.1
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.06
83 0.06
84 0.08
85 0.08
86 0.08
87 0.09
88 0.1
89 0.1
90 0.12
91 0.11
92 0.1
93 0.12
94 0.13
95 0.13
96 0.16
97 0.18
98 0.19
99 0.21
100 0.2
101 0.2
102 0.19
103 0.22
104 0.23
105 0.25
106 0.25
107 0.27
108 0.27
109 0.3
110 0.33
111 0.32
112 0.29
113 0.28
114 0.25
115 0.24
116 0.24
117 0.21
118 0.18
119 0.18
120 0.17
121 0.14
122 0.14
123 0.14
124 0.12
125 0.12
126 0.11
127 0.09
128 0.11
129 0.12
130 0.13
131 0.13
132 0.14
133 0.19
134 0.23
135 0.3
136 0.3
137 0.32
138 0.33
139 0.34
140 0.33
141 0.3
142 0.27
143 0.2
144 0.16
145 0.13
146 0.11
147 0.08
148 0.09
149 0.08
150 0.08
151 0.07
152 0.06
153 0.07
154 0.07
155 0.07
156 0.06
157 0.05
158 0.06
159 0.06
160 0.06
161 0.08
162 0.13
163 0.16
164 0.17
165 0.17
166 0.18
167 0.18
168 0.2
169 0.18
170 0.13
171 0.12
172 0.12
173 0.14
174 0.19
175 0.2
176 0.18
177 0.19
178 0.2
179 0.22
180 0.22
181 0.24
182 0.22
183 0.21
184 0.23
185 0.27
186 0.3
187 0.26
188 0.25
189 0.23
190 0.2
191 0.21
192 0.19
193 0.15
194 0.1
195 0.1
196 0.1
197 0.09
198 0.07
199 0.05
200 0.05
201 0.04
202 0.05
203 0.06
204 0.05
205 0.05
206 0.06
207 0.06
208 0.08
209 0.08
210 0.09
211 0.1
212 0.13
213 0.13
214 0.14
215 0.15
216 0.14
217 0.16
218 0.15
219 0.13
220 0.1
221 0.1
222 0.07
223 0.07
224 0.06
225 0.04
226 0.05
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.06
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.05
243 0.04
244 0.03
245 0.03
246 0.03
247 0.03
248 0.03
249 0.04
250 0.04
251 0.05
252 0.06
253 0.07
254 0.08
255 0.1
256 0.16
257 0.2
258 0.23
259 0.31
260 0.31
261 0.31
262 0.32
263 0.3
264 0.26
265 0.24
266 0.21
267 0.14
268 0.14
269 0.13
270 0.13
271 0.12
272 0.09
273 0.07
274 0.06
275 0.04
276 0.04
277 0.04
278 0.03
279 0.03
280 0.04
281 0.05
282 0.07
283 0.1
284 0.11
285 0.14
286 0.15
287 0.16
288 0.18
289 0.21
290 0.2
291 0.25
292 0.26
293 0.26
294 0.27
295 0.27
296 0.26
297 0.24
298 0.24
299 0.18
300 0.25
301 0.23
302 0.21
303 0.23
304 0.22
305 0.21
306 0.25
307 0.27
308 0.19
309 0.21
310 0.21
311 0.25
312 0.26
313 0.27
314 0.27
315 0.25
316 0.27
317 0.33
318 0.43
319 0.44
320 0.52
321 0.55
322 0.58
323 0.58
324 0.62
325 0.64
326 0.6
327 0.63
328 0.6
329 0.57
330 0.57
331 0.62
332 0.56
333 0.49
334 0.42
335 0.33
336 0.28
337 0.25
338 0.22
339 0.16
340 0.16
341 0.16
342 0.16
343 0.16
344 0.14
345 0.13
346 0.13
347 0.09
348 0.08
349 0.07
350 0.06
351 0.06
352 0.06
353 0.05
354 0.05
355 0.06
356 0.08
357 0.08
358 0.08
359 0.09
360 0.1
361 0.11
362 0.11
363 0.11
364 0.09
365 0.12
366 0.16
367 0.16