Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9PRZ4

Protein Details
Accession A0A1J9PRZ4    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
372-402ISPEERRKQEQLPRNPKKRMYEEKVVDERKKBasic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005606  Sec20  
Gene Ontology GO:0016020  C:membrane  
GO:0005484  F:SNAP receptor activity  
GO:0006890  P:retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum  
Pfam View protein in Pfam  
PF03908  Sec20  
Amino Acid Sequences MVSPGLQALITSLSTSHKQTIPLIHRLQNLPATPGTGDDARLELGAEIHLRLKGMEEQMELLRVELEQLEATRNRKMESGAKEAERERVVVVIGKLDEDLKSARIQFRKAQLQAKRNAEAGRQKERQLLFAGVEGGEGGEGVRRKGRAGLTHDDLVATASEDITSALRRTHQLMQAELSRSQFAQETLEQSTAALSSLSESYNALDTLLASSRSLVTSLLRSQKSDTWYLETAFYILVGTIIWLVFRRILYGPLWWILWMPLKLMVRMTFAVLGGMGLANTITSTQLSGSPNQQAPTSIALGSSGANLLPKTPPMTISGVTTQSTAASSSLSSSDGPETTPQADSESILDRVEQIVENGNDNKEKGTNVDDISPEERRKQEQLPRNPKKRMYEEKVVDERKKDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.23
4 0.24
5 0.26
6 0.31
7 0.39
8 0.42
9 0.48
10 0.52
11 0.52
12 0.56
13 0.55
14 0.55
15 0.52
16 0.46
17 0.41
18 0.35
19 0.31
20 0.25
21 0.24
22 0.23
23 0.17
24 0.17
25 0.15
26 0.15
27 0.14
28 0.14
29 0.13
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.11
36 0.11
37 0.11
38 0.11
39 0.13
40 0.16
41 0.19
42 0.2
43 0.19
44 0.21
45 0.21
46 0.24
47 0.21
48 0.16
49 0.13
50 0.11
51 0.11
52 0.09
53 0.09
54 0.07
55 0.08
56 0.13
57 0.16
58 0.19
59 0.22
60 0.23
61 0.24
62 0.24
63 0.28
64 0.31
65 0.33
66 0.39
67 0.4
68 0.4
69 0.43
70 0.43
71 0.45
72 0.38
73 0.32
74 0.25
75 0.2
76 0.19
77 0.18
78 0.17
79 0.14
80 0.13
81 0.13
82 0.13
83 0.13
84 0.12
85 0.11
86 0.12
87 0.1
88 0.12
89 0.16
90 0.22
91 0.25
92 0.28
93 0.32
94 0.4
95 0.47
96 0.5
97 0.55
98 0.57
99 0.61
100 0.66
101 0.66
102 0.6
103 0.55
104 0.51
105 0.49
106 0.49
107 0.47
108 0.48
109 0.46
110 0.46
111 0.49
112 0.48
113 0.44
114 0.39
115 0.34
116 0.24
117 0.22
118 0.21
119 0.14
120 0.13
121 0.1
122 0.07
123 0.05
124 0.04
125 0.03
126 0.05
127 0.06
128 0.07
129 0.09
130 0.1
131 0.11
132 0.15
133 0.18
134 0.22
135 0.28
136 0.33
137 0.34
138 0.35
139 0.34
140 0.3
141 0.27
142 0.21
143 0.15
144 0.1
145 0.06
146 0.04
147 0.04
148 0.04
149 0.05
150 0.05
151 0.06
152 0.06
153 0.07
154 0.08
155 0.1
156 0.14
157 0.18
158 0.22
159 0.23
160 0.23
161 0.25
162 0.27
163 0.28
164 0.26
165 0.22
166 0.18
167 0.16
168 0.16
169 0.14
170 0.11
171 0.11
172 0.11
173 0.12
174 0.13
175 0.13
176 0.12
177 0.11
178 0.11
179 0.08
180 0.07
181 0.05
182 0.03
183 0.04
184 0.05
185 0.05
186 0.05
187 0.05
188 0.06
189 0.07
190 0.07
191 0.06
192 0.05
193 0.05
194 0.05
195 0.06
196 0.06
197 0.05
198 0.06
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.08
205 0.12
206 0.19
207 0.19
208 0.2
209 0.22
210 0.25
211 0.27
212 0.29
213 0.26
214 0.23
215 0.24
216 0.24
217 0.23
218 0.19
219 0.16
220 0.12
221 0.11
222 0.06
223 0.05
224 0.04
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.06
233 0.06
234 0.08
235 0.09
236 0.11
237 0.11
238 0.12
239 0.13
240 0.12
241 0.13
242 0.1
243 0.1
244 0.1
245 0.13
246 0.12
247 0.11
248 0.15
249 0.16
250 0.16
251 0.18
252 0.17
253 0.16
254 0.16
255 0.16
256 0.12
257 0.11
258 0.1
259 0.08
260 0.07
261 0.05
262 0.04
263 0.03
264 0.03
265 0.03
266 0.02
267 0.03
268 0.03
269 0.03
270 0.03
271 0.04
272 0.05
273 0.09
274 0.11
275 0.13
276 0.16
277 0.21
278 0.23
279 0.24
280 0.24
281 0.21
282 0.21
283 0.22
284 0.2
285 0.15
286 0.12
287 0.12
288 0.12
289 0.11
290 0.09
291 0.07
292 0.06
293 0.07
294 0.07
295 0.08
296 0.09
297 0.1
298 0.12
299 0.12
300 0.13
301 0.16
302 0.19
303 0.18
304 0.2
305 0.22
306 0.22
307 0.22
308 0.21
309 0.18
310 0.15
311 0.15
312 0.12
313 0.09
314 0.08
315 0.07
316 0.08
317 0.09
318 0.1
319 0.09
320 0.1
321 0.12
322 0.12
323 0.13
324 0.14
325 0.16
326 0.16
327 0.17
328 0.16
329 0.16
330 0.17
331 0.16
332 0.17
333 0.17
334 0.16
335 0.16
336 0.15
337 0.13
338 0.14
339 0.15
340 0.12
341 0.1
342 0.16
343 0.17
344 0.21
345 0.23
346 0.25
347 0.25
348 0.26
349 0.27
350 0.21
351 0.21
352 0.2
353 0.22
354 0.24
355 0.23
356 0.27
357 0.26
358 0.28
359 0.32
360 0.36
361 0.35
362 0.37
363 0.39
364 0.41
365 0.45
366 0.5
367 0.56
368 0.6
369 0.68
370 0.73
371 0.8
372 0.84
373 0.88
374 0.86
375 0.86
376 0.86
377 0.86
378 0.83
379 0.83
380 0.8
381 0.81
382 0.84
383 0.83
384 0.78
385 0.72