Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BCU4

Protein Details
Accession G8BCU4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-65NVPKTRRTYCKGRECRKHTQHKVTQYKAHydrophilic
NLS Segment(s)
PositionSequence
75-85KRRYDRKQKGY
90-98KPVFHKKAK
Subcellular Location(s) mito 20, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MLVRFSTKQKENLIVRKILSYFLKAFIKPLSKQDKMVNVPKTRRTYCKGRECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQKGYGGQTKPVFHKKAKTTKKVVLRLECVVCKTKAQLALKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.51
4 0.47
5 0.42
6 0.36
7 0.31
8 0.27
9 0.29
10 0.32
11 0.28
12 0.29
13 0.3
14 0.33
15 0.31
16 0.38
17 0.41
18 0.4
19 0.43
20 0.46
21 0.5
22 0.5
23 0.56
24 0.55
25 0.54
26 0.58
27 0.62
28 0.65
29 0.61
30 0.61
31 0.59
32 0.61
33 0.63
34 0.68
35 0.71
36 0.73
37 0.79
38 0.8
39 0.85
40 0.85
41 0.86
42 0.84
43 0.84
44 0.81
45 0.81
46 0.83
47 0.74
48 0.73
49 0.65
50 0.6
51 0.52
52 0.47
53 0.36
54 0.29
55 0.28
56 0.27
57 0.26
58 0.23
59 0.29
60 0.33
61 0.36
62 0.41
63 0.45
64 0.45
65 0.54
66 0.62
67 0.63
68 0.66
69 0.68
70 0.7
71 0.73
72 0.75
73 0.68
74 0.66
75 0.61
76 0.54
77 0.55
78 0.55
79 0.5
80 0.44
81 0.48
82 0.49
83 0.56
84 0.63
85 0.66
86 0.65
87 0.69
88 0.75
89 0.75
90 0.74
91 0.7
92 0.64
93 0.61
94 0.58
95 0.53
96 0.46
97 0.42
98 0.35
99 0.3
100 0.28
101 0.27
102 0.31
103 0.36
104 0.39
105 0.44
106 0.54
107 0.62
108 0.67
109 0.65
110 0.6
111 0.57
112 0.52
113 0.51
114 0.51
115 0.51
116 0.54
117 0.6
118 0.58
119 0.59
120 0.62
121 0.58