Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QH41

Protein Details
Accession A0A1J9QH41    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-87MTFACKKCKKCFRKDAREFEESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Amino Acid Sequences MPKFPSVRRVVSTSNKPPDTPPTQNKNNTPPTSPPCLLRYPRRRWFDCAECHQEKEDHELLQSFDMTFACKKCKKCFRKDAREFEESDEYCPHCDNHFVLEALTPKPALKIEGEDARIDSRMLKDERVRPEEERTIFNVKDAPNRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.62
3 0.59
4 0.57
5 0.58
6 0.57
7 0.57
8 0.57
9 0.57
10 0.64
11 0.7
12 0.73
13 0.74
14 0.75
15 0.69
16 0.63
17 0.61
18 0.58
19 0.59
20 0.54
21 0.48
22 0.42
23 0.47
24 0.49
25 0.52
26 0.57
27 0.58
28 0.66
29 0.71
30 0.71
31 0.69
32 0.7
33 0.68
34 0.65
35 0.63
36 0.63
37 0.56
38 0.54
39 0.5
40 0.44
41 0.37
42 0.36
43 0.3
44 0.22
45 0.2
46 0.19
47 0.18
48 0.17
49 0.16
50 0.09
51 0.07
52 0.07
53 0.08
54 0.09
55 0.1
56 0.16
57 0.2
58 0.24
59 0.32
60 0.43
61 0.5
62 0.58
63 0.68
64 0.73
65 0.79
66 0.86
67 0.87
68 0.82
69 0.77
70 0.68
71 0.61
72 0.57
73 0.46
74 0.39
75 0.31
76 0.25
77 0.23
78 0.22
79 0.2
80 0.12
81 0.14
82 0.13
83 0.13
84 0.14
85 0.14
86 0.13
87 0.14
88 0.16
89 0.15
90 0.15
91 0.12
92 0.1
93 0.12
94 0.12
95 0.11
96 0.1
97 0.13
98 0.17
99 0.22
100 0.23
101 0.22
102 0.23
103 0.23
104 0.22
105 0.2
106 0.17
107 0.14
108 0.2
109 0.21
110 0.25
111 0.31
112 0.38
113 0.46
114 0.49
115 0.51
116 0.47
117 0.53
118 0.57
119 0.52
120 0.48
121 0.44
122 0.46
123 0.42
124 0.4
125 0.38
126 0.32
127 0.38