Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PEL9

Protein Details
Accession A0A1J9PEL9   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
107-127GNENYRKTERRRRELEPKGISBasic
NLS Segment(s)
Subcellular Location(s) mito 9.5, extr 8, cyto_mito 6.5, nucl 5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006115  6PGDH_NADP-bd  
IPR036291  NAD(P)-bd_dom_sf  
IPR006183  Pgluconate_DH  
Gene Ontology GO:0050661  F:NADP binding  
GO:0004616  F:phosphogluconate dehydrogenase (decarboxylating) activity  
Pfam View protein in Pfam  
PF03446  NAD_binding_2  
Amino Acid Sequences MRTLHYYQNNQPFLPLNLSNILASLVLAAWAQWCPSGSQSLASTYHFGDVKNSNVDEAISMSRNEKKMKRKISGCYDMHKFAESVKHAVVEGSGNDLRKGDIMFDGGNENYRKTERRRRELEPKGISWVGMGLTGGYPSARHGPSVALG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.32
3 0.25
4 0.24
5 0.25
6 0.22
7 0.2
8 0.17
9 0.11
10 0.1
11 0.08
12 0.05
13 0.05
14 0.05
15 0.04
16 0.05
17 0.05
18 0.05
19 0.06
20 0.06
21 0.07
22 0.08
23 0.11
24 0.1
25 0.13
26 0.13
27 0.15
28 0.16
29 0.16
30 0.17
31 0.15
32 0.17
33 0.16
34 0.15
35 0.16
36 0.17
37 0.18
38 0.2
39 0.19
40 0.16
41 0.16
42 0.16
43 0.12
44 0.11
45 0.1
46 0.08
47 0.09
48 0.11
49 0.15
50 0.18
51 0.23
52 0.27
53 0.36
54 0.43
55 0.51
56 0.56
57 0.58
58 0.62
59 0.66
60 0.69
61 0.61
62 0.57
63 0.53
64 0.47
65 0.42
66 0.36
67 0.27
68 0.19
69 0.22
70 0.19
71 0.17
72 0.15
73 0.15
74 0.14
75 0.14
76 0.13
77 0.09
78 0.07
79 0.1
80 0.11
81 0.11
82 0.12
83 0.12
84 0.12
85 0.12
86 0.12
87 0.08
88 0.07
89 0.08
90 0.08
91 0.08
92 0.1
93 0.09
94 0.14
95 0.14
96 0.14
97 0.15
98 0.18
99 0.23
100 0.3
101 0.41
102 0.46
103 0.56
104 0.62
105 0.68
106 0.76
107 0.81
108 0.82
109 0.78
110 0.69
111 0.66
112 0.59
113 0.51
114 0.4
115 0.31
116 0.2
117 0.14
118 0.12
119 0.06
120 0.06
121 0.07
122 0.07
123 0.06
124 0.06
125 0.08
126 0.16
127 0.16
128 0.16
129 0.17