Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9Q324

Protein Details
Accession A0A1J9Q324    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
6-32WKIPWRLSAPQKARQRKRLRAVDKVVDHydrophilic
66-92KYTIFDRKEKKYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
73-86KEKKYRKGIHKLPK
Subcellular Location(s) mito 23.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MGGLLWKIPWRLSAPQKARQRKRLRAVDKVVDTVSSALERKGMTSKAVTRWFDEMPREEEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.57
3 0.67
4 0.74
5 0.79
6 0.81
7 0.83
8 0.83
9 0.86
10 0.88
11 0.85
12 0.83
13 0.81
14 0.79
15 0.7
16 0.62
17 0.52
18 0.41
19 0.34
20 0.25
21 0.18
22 0.12
23 0.1
24 0.08
25 0.09
26 0.09
27 0.1
28 0.12
29 0.12
30 0.12
31 0.14
32 0.18
33 0.22
34 0.28
35 0.28
36 0.27
37 0.29
38 0.28
39 0.28
40 0.27
41 0.24
42 0.21
43 0.22
44 0.21
45 0.18
46 0.2
47 0.21
48 0.24
49 0.22
50 0.19
51 0.19
52 0.19
53 0.22
54 0.25
55 0.32
56 0.29
57 0.38
58 0.45
59 0.53
60 0.62
61 0.68
62 0.71
63 0.72
64 0.78
65 0.8
66 0.84
67 0.85
68 0.86
69 0.86
70 0.89
71 0.87
72 0.87
73 0.82
74 0.8
75 0.8
76 0.79
77 0.8
78 0.77
79 0.79