Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9NZV4

Protein Details
Accession A0A1J9NZV4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-42IDLESRSRRVVKKRRLNSRAFERFRHydrophilic
NLS Segment(s)
PositionSequence
24-48SRRVVKKRRLNSRAFERFRQRKKAK
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
Amino Acid Sequences MLQTVTESAQIWLGTINIDLESRSRRVVKKRRLNSRAFERFRQRKKAKMEEMQETIERLTKECDYLRCLCHRLGKSREAEIDSIFDGGLSQLRTLVPGYARRVAQEFLSRYGSGGSQSSTLMKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.1
8 0.13
9 0.15
10 0.18
11 0.24
12 0.3
13 0.4
14 0.51
15 0.59
16 0.66
17 0.74
18 0.81
19 0.83
20 0.83
21 0.81
22 0.82
23 0.82
24 0.76
25 0.74
26 0.74
27 0.76
28 0.77
29 0.79
30 0.73
31 0.7
32 0.74
33 0.76
34 0.74
35 0.71
36 0.68
37 0.63
38 0.62
39 0.56
40 0.47
41 0.38
42 0.29
43 0.24
44 0.2
45 0.14
46 0.13
47 0.11
48 0.13
49 0.14
50 0.16
51 0.17
52 0.19
53 0.21
54 0.22
55 0.24
56 0.24
57 0.3
58 0.31
59 0.36
60 0.37
61 0.41
62 0.41
63 0.41
64 0.42
65 0.36
66 0.34
67 0.26
68 0.23
69 0.17
70 0.15
71 0.12
72 0.09
73 0.07
74 0.06
75 0.08
76 0.07
77 0.06
78 0.07
79 0.07
80 0.08
81 0.09
82 0.11
83 0.12
84 0.17
85 0.21
86 0.25
87 0.26
88 0.26
89 0.29
90 0.27
91 0.28
92 0.3
93 0.28
94 0.28
95 0.31
96 0.3
97 0.27
98 0.28
99 0.25
100 0.19
101 0.18
102 0.15
103 0.12
104 0.13
105 0.18