Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9Q4G8

Protein Details
Accession A0A1J9Q4G8   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-106KIVRVRSREGRRNRAPPPRIRYNRDGKKMNBasic
NLS Segment(s)
PositionSequence
80-104RVRSREGRRNRAPPPRIRYNRDGKK
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MDSGRNKNGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFTDYAVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRYNRDGKKMNPTQAAKTAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.72
4 0.65
5 0.68
6 0.67
7 0.67
8 0.67
9 0.67
10 0.65
11 0.66
12 0.69
13 0.7
14 0.73
15 0.72
16 0.73
17 0.74
18 0.76
19 0.72
20 0.73
21 0.69
22 0.69
23 0.61
24 0.53
25 0.47
26 0.38
27 0.35
28 0.28
29 0.25
30 0.16
31 0.15
32 0.12
33 0.1
34 0.1
35 0.08
36 0.08
37 0.06
38 0.05
39 0.06
40 0.06
41 0.06
42 0.08
43 0.08
44 0.09
45 0.09
46 0.09
47 0.09
48 0.1
49 0.12
50 0.15
51 0.16
52 0.18
53 0.21
54 0.22
55 0.22
56 0.24
57 0.22
58 0.18
59 0.19
60 0.17
61 0.19
62 0.19
63 0.21
64 0.21
65 0.27
66 0.3
67 0.31
68 0.34
69 0.39
70 0.48
71 0.55
72 0.61
73 0.65
74 0.69
75 0.75
76 0.8
77 0.81
78 0.79
79 0.8
80 0.79
81 0.8
82 0.8
83 0.79
84 0.79
85 0.79
86 0.81
87 0.8
88 0.79
89 0.71
90 0.74
91 0.74
92 0.74
93 0.72
94 0.65
95 0.62
96 0.63