Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BHH9

Protein Details
Accession G8BHH9   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-64RSRMGCLTCRQRKKRCCESRPKCTECGHydrophilic
71-90VWPKPGTEHKNKPKDQKEDEBasic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MVQPNSIPHPYQQQNSNVPSSTSSAPSSASSSKSVTRRSRMGCLTCRQRKKRCCESRPKCTECGRLGLNCVWPKPGTEHKNKPKDQKEDENTIEHEIYGRIKVLRGIVEYRSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.53
4 0.44
5 0.39
6 0.36
7 0.33
8 0.28
9 0.23
10 0.21
11 0.18
12 0.18
13 0.19
14 0.21
15 0.19
16 0.19
17 0.19
18 0.2
19 0.25
20 0.29
21 0.36
22 0.39
23 0.42
24 0.47
25 0.48
26 0.53
27 0.53
28 0.53
29 0.5
30 0.52
31 0.57
32 0.6
33 0.66
34 0.69
35 0.73
36 0.75
37 0.79
38 0.82
39 0.82
40 0.83
41 0.84
42 0.84
43 0.85
44 0.86
45 0.8
46 0.75
47 0.69
48 0.67
49 0.57
50 0.52
51 0.44
52 0.35
53 0.34
54 0.3
55 0.31
56 0.26
57 0.25
58 0.22
59 0.2
60 0.21
61 0.23
62 0.31
63 0.32
64 0.4
65 0.51
66 0.59
67 0.69
68 0.74
69 0.79
70 0.79
71 0.81
72 0.79
73 0.79
74 0.75
75 0.73
76 0.7
77 0.64
78 0.57
79 0.51
80 0.43
81 0.32
82 0.26
83 0.19
84 0.18
85 0.15
86 0.16
87 0.13
88 0.14
89 0.16
90 0.18
91 0.2
92 0.22
93 0.24