Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8B6X4

Protein Details
Accession G8B6X4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-33NAKFEKKVTKHWGKPKSDKEKVBasic
NLS Segment(s)
PositionSequence
17-26KKVTKHWGKP
Subcellular Location(s) mito 12, plas 5, E.R. 5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MALQTPKQRAANAKFEKKVTKHWGKPKSDKEKVEYPVSKTWLFVLLFLVAGGAVLELIRMLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.65
4 0.59
5 0.62
6 0.61
7 0.62
8 0.62
9 0.68
10 0.73
11 0.73
12 0.8
13 0.81
14 0.81
15 0.79
16 0.73
17 0.68
18 0.67
19 0.62
20 0.61
21 0.53
22 0.47
23 0.44
24 0.45
25 0.4
26 0.33
27 0.3
28 0.27
29 0.24
30 0.2
31 0.16
32 0.13
33 0.12
34 0.12
35 0.11
36 0.05
37 0.05
38 0.05
39 0.03
40 0.03
41 0.02
42 0.02