Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3B0G6

Protein Details
Accession G3B0G6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-26AVQTPKQRLANKKFSKKNTLKQTGQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6, plas 5, E.R. 5, golg 4, cyto_mito 4, cyto 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
KEGG cten:CANTEDRAFT_113121  -  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAVQTPKQRLANKKFSKKNTLKQTGQFKEDADKVEYPLPKAWIALLVFLVCGGALLEVLRLVFDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.84
4 0.83
5 0.83
6 0.83
7 0.81
8 0.76
9 0.75
10 0.78
11 0.71
12 0.65
13 0.56
14 0.45
15 0.41
16 0.38
17 0.32
18 0.24
19 0.21
20 0.19
21 0.23
22 0.23
23 0.2
24 0.2
25 0.2
26 0.17
27 0.17
28 0.15
29 0.15
30 0.14
31 0.13
32 0.11
33 0.09
34 0.09
35 0.09
36 0.08
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.04