FuNGI

G8BBQ1

Protein Details

Accession

G8BBQ1

Localization Confidence

Medium

Confidence Score

14.7

NoLS Segment(s)

Position	Sequence	Protein Nature
3-40	GDPFLSDPSKKRKRSNKVTSTTRTKKSKSTTPQPSTTT	Hydrophilic

NLS Segment(s)

Position	Sequence
12-19	KKRKRSNK
343-348	KKRKKK

Subcellular Location(s)

nucl 18, cyto_nucl 13.5, cyto 7

Family & Domain DBs

InterPro	View protein in InterPro IPR015943 WD40/YVTN_repeat-like_dom_sf IPR001680 WD40_repeat IPR036322 WD40_repeat_dom_sf
Gene Ontology	GO:0031428 C:box C/D RNP complex GO:0005730 C:nucleolus GO:0032040 C:small-subunit processome GO:0034511 F:U3 snoRNA binding GO:0000480 P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) GO:0000447 P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) GO:0000472 P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
Pfam	View protein in Pfam PF00400 WD40
PROSITE	View protein in PROSITE PS50082 WD_REPEATS_2 PS50294 WD_REPEATS_REGION

Amino Acid Sequences

MAGDPFLSDPSKKRKRSNKVTSTTRTKKSKSTTPQPSTTTSQYDEEISSASDTENEQSVEDQRQEEELSSDEEFATESAADKRRRLAKQYLENLKNEELRDSEDFDAQDLDDEILAKRLQVDVADAKGHVYKFWGDKISQQLDGDEIKLTTTRIGSKNVTSMCIHFPYLYTVSKDVEIIKWNINSGKNPQRIKHTKGGSKYFTLNTTQPGLNHHWEQINCIAASPDGKYIVTGGSDSRLIIWSSENLACLKVLPTRSAVNSIVFRRNTDQLFAACADLRVRTYSINQFTQLETLYGHQDNITDIASLARETCVSVGSRDKTAMFWKIPEESRLTFRGGDSVEKKRKKKSDEDEEIGNDEPFHSEGSIDVVSMIDESHFVTGSDNGNIALWSLAKKKAQNTKRLAHGLQPQFQPQQASAELATNVASRQIPAPQPHWITAIHAPAYSDIFFSGSFGGTIKIWKLDSTLRTFTLIGEVENLRGFVVKIDSVEILDTKQLKVFVLVSKEHKFGRWFGKVPGGRNALISFTFSI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.69
2	0.78
3	0.86
4	0.9
5	0.9
6	0.89
7	0.92
8	0.91
9	0.91
10	0.9
11	0.88
12	0.86
13	0.8
14	0.79
15	0.77
16	0.77
17	0.77
18	0.78
19	0.8
20	0.78
21	0.81
22	0.76
23	0.74
24	0.69
25	0.64
26	0.57
27	0.49
28	0.44
29	0.37
30	0.36
31	0.3
32	0.25
33	0.21
34	0.17
35	0.14
36	0.12
37	0.11
38	0.1
39	0.1
40	0.12
41	0.13
42	0.13
43	0.13
44	0.14
45	0.18
46	0.21
47	0.22
48	0.21
49	0.2
50	0.21
51	0.22
52	0.2
53	0.18
54	0.15
55	0.16
56	0.15
57	0.15
58	0.13
59	0.12
60	0.12
61	0.1
62	0.1
63	0.07
64	0.08
65	0.14
66	0.22
67	0.25
68	0.26
69	0.33
70	0.42
71	0.47
72	0.52
73	0.55
74	0.57
75	0.64
76	0.73
77	0.76
78	0.72
79	0.69
80	0.66
81	0.61
82	0.55
83	0.45
84	0.38
85	0.28
86	0.28
87	0.28
88	0.28
89	0.25
90	0.24
91	0.23
92	0.21
93	0.21
94	0.16
95	0.15
96	0.11
97	0.1
98	0.07
99	0.08
100	0.08
101	0.1
102	0.1
103	0.09
104	0.09
105	0.09
106	0.1
107	0.09
108	0.12
109	0.12
110	0.14
111	0.15
112	0.14
113	0.14
114	0.17
115	0.17
116	0.14
117	0.13
118	0.15
119	0.17
120	0.21
121	0.23
122	0.2
123	0.25
124	0.33
125	0.34
126	0.33
127	0.3
128	0.27
129	0.26
130	0.26
131	0.22
132	0.14
133	0.11
134	0.1
135	0.1
136	0.1
137	0.09
138	0.1
139	0.16
140	0.17
141	0.22
142	0.24
143	0.24
144	0.3
145	0.29
146	0.3
147	0.25
148	0.25
149	0.24
150	0.24
151	0.23
152	0.17
153	0.17
154	0.19
155	0.21
156	0.2
157	0.18
158	0.18
159	0.18
160	0.18
161	0.19
162	0.16
163	0.15
164	0.16
165	0.17
166	0.19
167	0.18
168	0.19
169	0.23
170	0.23
171	0.24
172	0.28
173	0.35
174	0.4
175	0.43
176	0.44
177	0.51
178	0.56
179	0.6
180	0.6
181	0.58
182	0.56
183	0.6
184	0.64
185	0.57
186	0.53
187	0.5
188	0.43
189	0.37
190	0.35
191	0.29
192	0.24
193	0.24
194	0.22
195	0.19
196	0.22
197	0.24
198	0.25
199	0.25
200	0.24
201	0.25
202	0.24
203	0.26
204	0.24
205	0.21
206	0.17
207	0.16
208	0.14
209	0.11
210	0.12
211	0.1
212	0.09
213	0.08
214	0.08
215	0.07
216	0.08
217	0.08
218	0.07
219	0.06
220	0.06
221	0.06
222	0.06
223	0.06
224	0.06
225	0.07
226	0.07
227	0.07
228	0.08
229	0.07
230	0.1
231	0.1
232	0.11
233	0.1
234	0.1
235	0.09
236	0.09
237	0.09
238	0.1
239	0.1
240	0.1
241	0.12
242	0.13
243	0.14
244	0.17
245	0.16
246	0.16
247	0.19
248	0.21
249	0.25
250	0.23
251	0.24
252	0.24
253	0.26
254	0.25
255	0.22
256	0.21
257	0.15
258	0.16
259	0.15
260	0.13
261	0.1
262	0.1
263	0.09
264	0.08
265	0.08
266	0.08
267	0.08
268	0.08
269	0.11
270	0.17
271	0.2
272	0.21
273	0.22
274	0.22
275	0.21
276	0.21
277	0.18
278	0.13
279	0.09
280	0.09
281	0.11
282	0.1
283	0.1
284	0.09
285	0.09
286	0.09
287	0.1
288	0.09
289	0.06
290	0.06
291	0.06
292	0.06
293	0.06
294	0.06
295	0.05
296	0.05
297	0.05
298	0.05
299	0.06
300	0.06
301	0.08
302	0.13
303	0.14
304	0.15
305	0.16
306	0.16
307	0.16
308	0.19
309	0.22
310	0.18
311	0.17
312	0.18
313	0.22
314	0.23
315	0.23
316	0.24
317	0.21
318	0.24
319	0.25
320	0.24
321	0.21
322	0.2
323	0.21
324	0.18
325	0.22
326	0.24
327	0.32
328	0.4
329	0.47
330	0.52
331	0.57
332	0.64
333	0.65
334	0.7
335	0.7
336	0.72
337	0.73
338	0.72
339	0.67
340	0.6
341	0.56
342	0.46
343	0.36
344	0.25
345	0.16
346	0.13
347	0.1
348	0.09
349	0.07
350	0.06
351	0.06
352	0.09
353	0.08
354	0.07
355	0.07
356	0.07
357	0.06
358	0.07
359	0.06
360	0.03
361	0.04
362	0.05
363	0.05
364	0.05
365	0.05
366	0.06
367	0.09
368	0.1
369	0.11
370	0.1
371	0.1
372	0.1
373	0.1
374	0.09
375	0.07
376	0.06
377	0.08
378	0.11
379	0.15
380	0.19
381	0.22
382	0.3
383	0.4
384	0.47
385	0.54
386	0.59
387	0.61
388	0.66
389	0.68
390	0.62
391	0.58
392	0.61
393	0.57
394	0.57
395	0.53
396	0.49
397	0.45
398	0.46
399	0.4
400	0.31
401	0.29
402	0.23
403	0.22
404	0.18
405	0.18
406	0.16
407	0.15
408	0.15
409	0.11
410	0.1
411	0.11
412	0.11
413	0.09
414	0.11
415	0.16
416	0.21
417	0.24
418	0.27
419	0.32
420	0.35
421	0.35
422	0.36
423	0.3
424	0.29
425	0.3
426	0.32
427	0.25
428	0.23
429	0.22
430	0.21
431	0.23
432	0.19
433	0.15
434	0.11
435	0.11
436	0.1
437	0.1
438	0.1
439	0.08
440	0.08
441	0.08
442	0.09
443	0.08
444	0.11
445	0.11
446	0.13
447	0.13
448	0.14
449	0.16
450	0.22
451	0.27
452	0.31
453	0.34
454	0.32
455	0.34
456	0.34
457	0.31
458	0.3
459	0.25
460	0.18
461	0.19
462	0.18
463	0.18
464	0.18
465	0.18
466	0.12
467	0.12
468	0.12
469	0.1
470	0.12
471	0.12
472	0.12
473	0.14
474	0.14
475	0.14
476	0.15
477	0.13
478	0.12
479	0.16
480	0.17
481	0.16
482	0.18
483	0.19
484	0.18
485	0.2
486	0.22
487	0.22
488	0.25
489	0.29
490	0.34
491	0.38
492	0.41
493	0.4
494	0.42
495	0.4
496	0.42
497	0.47
498	0.49
499	0.47
500	0.47
501	0.56
502	0.56
503	0.57
504	0.59
505	0.54
506	0.46
507	0.46
508	0.42
509	0.35
510	0.31

G8BBQ1

3D AlphaFold-predicted Structure Viewer