Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E1LMZ5

Protein Details
Accession A0A1E1LMZ5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
96-123APKTPNGKITKRKATPKKTSAKKAAVKTHydrophilic
NLS Segment(s)
PositionSequence
87-120LRKVKKTPGAPKTPNGKITKRKATPKKTSAKKAA
Subcellular Location(s) cyto 19.5, cyto_nucl 14.333, cyto_mito 10.666, nucl 7
Family & Domain DBs
Amino Acid Sequences MSDVDITAAAGKAEAMSQADTDFILVCIKNAIGGVLTVDGNKIAAELNYTNPRSVTNKISAIKKKYGLPISTASASKTSADFASAPLRKVKKTPGAPKTPNGKITKRKATPKKTSAKKAAVKTAVKVESESESEQADAEMEDAKEEIDEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.08
6 0.09
7 0.08
8 0.08
9 0.07
10 0.06
11 0.08
12 0.08
13 0.08
14 0.09
15 0.08
16 0.09
17 0.08
18 0.08
19 0.05
20 0.05
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.05
30 0.04
31 0.04
32 0.07
33 0.07
34 0.12
35 0.19
36 0.2
37 0.2
38 0.2
39 0.22
40 0.23
41 0.25
42 0.25
43 0.22
44 0.27
45 0.31
46 0.38
47 0.43
48 0.44
49 0.45
50 0.43
51 0.43
52 0.43
53 0.44
54 0.37
55 0.34
56 0.32
57 0.3
58 0.29
59 0.26
60 0.2
61 0.16
62 0.16
63 0.13
64 0.11
65 0.09
66 0.07
67 0.08
68 0.08
69 0.08
70 0.16
71 0.17
72 0.18
73 0.22
74 0.24
75 0.24
76 0.26
77 0.32
78 0.33
79 0.4
80 0.49
81 0.52
82 0.6
83 0.63
84 0.68
85 0.69
86 0.65
87 0.64
88 0.6
89 0.59
90 0.59
91 0.65
92 0.68
93 0.67
94 0.73
95 0.76
96 0.8
97 0.83
98 0.83
99 0.84
100 0.83
101 0.86
102 0.84
103 0.84
104 0.81
105 0.77
106 0.76
107 0.74
108 0.67
109 0.6
110 0.59
111 0.52
112 0.45
113 0.4
114 0.33
115 0.27
116 0.29
117 0.27
118 0.2
119 0.18
120 0.17
121 0.16
122 0.14
123 0.12
124 0.08
125 0.07
126 0.09
127 0.08
128 0.09
129 0.09
130 0.09
131 0.08