Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E1L9B8

Protein Details
Accession A0A1E1L9B8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
83-112QNLRRRKGISLKEKKPPPKNRNPEFQARNGHydrophilic
NLS Segment(s)
PositionSequence
86-103RRRKGISLKEKKPPPKNR
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MRLGSVMLAPSEYENDTWPYYRFTTCSIQGSNANGLGNPTQNCKRFCFCQQHVVKEAGQADRPLDGRQVQVRPKALVDRNCVQNLRRRKGISLKEKKPPPKNRNPEFQARNGTYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.17
4 0.18
5 0.18
6 0.2
7 0.21
8 0.22
9 0.21
10 0.22
11 0.26
12 0.28
13 0.31
14 0.29
15 0.29
16 0.3
17 0.31
18 0.28
19 0.24
20 0.21
21 0.16
22 0.16
23 0.15
24 0.16
25 0.14
26 0.18
27 0.22
28 0.28
29 0.3
30 0.32
31 0.35
32 0.35
33 0.41
34 0.46
35 0.42
36 0.47
37 0.49
38 0.5
39 0.49
40 0.47
41 0.4
42 0.32
43 0.32
44 0.23
45 0.2
46 0.16
47 0.14
48 0.14
49 0.14
50 0.12
51 0.11
52 0.11
53 0.13
54 0.17
55 0.22
56 0.24
57 0.28
58 0.29
59 0.29
60 0.29
61 0.34
62 0.36
63 0.36
64 0.38
65 0.39
66 0.43
67 0.45
68 0.46
69 0.41
70 0.43
71 0.48
72 0.48
73 0.5
74 0.46
75 0.49
76 0.56
77 0.64
78 0.67
79 0.68
80 0.69
81 0.72
82 0.79
83 0.83
84 0.85
85 0.86
86 0.85
87 0.85
88 0.89
89 0.87
90 0.89
91 0.85
92 0.85
93 0.8
94 0.77
95 0.76