Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E1KZD8

Protein Details
Accession A0A1E1KZD8    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKRNKKSSQIKFKVRCQRHHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKRNKK
74-80KNAKGKR
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREISDIKNFIEICRRKDASSARIKRNKKSSQIKFKVRCQRHLYTLVLKDSEKAEKLKQSLPPNLTIADTPKKNAKGKRSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.42
4 0.37
5 0.44
6 0.49
7 0.48
8 0.54
9 0.58
10 0.59
11 0.67
12 0.71
13 0.72
14 0.76
15 0.75
16 0.74
17 0.76
18 0.76
19 0.78
20 0.83
21 0.85
22 0.81
23 0.83
24 0.83
25 0.76
26 0.75
27 0.7
28 0.64
29 0.59
30 0.57
31 0.5
32 0.46
33 0.45
34 0.38
35 0.33
36 0.29
37 0.25
38 0.23
39 0.23
40 0.19
41 0.19
42 0.2
43 0.24
44 0.27
45 0.31
46 0.36
47 0.4
48 0.46
49 0.46
50 0.46
51 0.42
52 0.4
53 0.36
54 0.3
55 0.29
56 0.3
57 0.29
58 0.29
59 0.35
60 0.42
61 0.49
62 0.55