Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E1L754

Protein Details
Accession A0A1E1L754    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-33ASKASKIPSKTPKPTTKQPNKPFVLEHydrophilic
NLS Segment(s)
PositionSequence
13-56KIPSKTPKPTTKQPNKPFVLEKPAKFNPPSHGARLRKEAPRYPG
Subcellular Location(s) mito 17, cyto_mito 12.666, mito_nucl 10.666, cyto 7, cyto_nucl 5.666
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALTIRHASKASKIPSKTPKPTTKQPNKPFVLEKPAKFNPPSHGARLRKEAPRYPGPKLSEEEAARQRTKKYPNMMPPEGTFLHWFMHNRSIHLYITLGTLFGLAATVWVSNFKRNSPFAEMLPARSDLLFHPIAFFRTFVEVVKMNADYVTAQTMERRKQKVEDVAKRAAYRKAHGLDKNEGFGGWTAKTDEQLLGPGIPVGDAEVVKEGEVEVQTESVTAPVVREKRPLKKWFGIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.62
3 0.7
4 0.73
5 0.74
6 0.77
7 0.76
8 0.84
9 0.86
10 0.86
11 0.87
12 0.87
13 0.88
14 0.81
15 0.79
16 0.75
17 0.69
18 0.69
19 0.65
20 0.58
21 0.57
22 0.57
23 0.57
24 0.54
25 0.51
26 0.46
27 0.47
28 0.49
29 0.47
30 0.52
31 0.52
32 0.54
33 0.59
34 0.6
35 0.58
36 0.61
37 0.6
38 0.58
39 0.63
40 0.62
41 0.6
42 0.6
43 0.56
44 0.53
45 0.5
46 0.45
47 0.42
48 0.39
49 0.4
50 0.4
51 0.42
52 0.41
53 0.41
54 0.42
55 0.42
56 0.48
57 0.48
58 0.49
59 0.52
60 0.58
61 0.65
62 0.64
63 0.58
64 0.52
65 0.5
66 0.43
67 0.35
68 0.27
69 0.19
70 0.18
71 0.17
72 0.18
73 0.15
74 0.22
75 0.21
76 0.21
77 0.23
78 0.24
79 0.22
80 0.21
81 0.19
82 0.12
83 0.12
84 0.11
85 0.08
86 0.06
87 0.06
88 0.05
89 0.04
90 0.04
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.07
97 0.07
98 0.11
99 0.12
100 0.14
101 0.17
102 0.19
103 0.22
104 0.24
105 0.25
106 0.21
107 0.28
108 0.26
109 0.24
110 0.24
111 0.22
112 0.16
113 0.15
114 0.15
115 0.08
116 0.13
117 0.12
118 0.1
119 0.11
120 0.11
121 0.13
122 0.13
123 0.13
124 0.09
125 0.11
126 0.11
127 0.1
128 0.12
129 0.11
130 0.11
131 0.13
132 0.12
133 0.1
134 0.1
135 0.1
136 0.07
137 0.07
138 0.08
139 0.07
140 0.07
141 0.11
142 0.16
143 0.22
144 0.3
145 0.32
146 0.33
147 0.36
148 0.42
149 0.48
150 0.53
151 0.56
152 0.55
153 0.57
154 0.58
155 0.57
156 0.54
157 0.51
158 0.43
159 0.37
160 0.38
161 0.37
162 0.42
163 0.44
164 0.46
165 0.48
166 0.47
167 0.46
168 0.38
169 0.33
170 0.26
171 0.23
172 0.2
173 0.13
174 0.12
175 0.13
176 0.13
177 0.14
178 0.15
179 0.14
180 0.12
181 0.14
182 0.14
183 0.11
184 0.11
185 0.1
186 0.09
187 0.08
188 0.07
189 0.06
190 0.07
191 0.06
192 0.07
193 0.09
194 0.09
195 0.09
196 0.09
197 0.09
198 0.09
199 0.1
200 0.1
201 0.09
202 0.09
203 0.09
204 0.09
205 0.09
206 0.07
207 0.08
208 0.07
209 0.07
210 0.15
211 0.2
212 0.22
213 0.31
214 0.39
215 0.48
216 0.58
217 0.65
218 0.66