Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8B7Y2

Protein Details
Accession G8B7Y2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
109-130LDKSGKPCQRWVKKSKQFKSFTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013175  INO80_su_Ies4  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08193  INO80_Ies4  
Amino Acid Sequences MAAARRLWVKLKLSSKYLATLPKFDPHVSKSRLKKIAQEEKKGVSPSISSSQRSSPAPEGTGTPGPSNSANNTGAAGSGISQYKINVGLKGDSTSGLTMNSINPALYILDKSGKPCQRWVKKSKQFKSFTGFKMKYTKYEPKEPGPKDGNKSGGNAAKEVSESAKSNITTIASEVKVET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.44
4 0.44
5 0.44
6 0.38
7 0.39
8 0.38
9 0.39
10 0.4
11 0.39
12 0.39
13 0.35
14 0.42
15 0.42
16 0.48
17 0.51
18 0.58
19 0.64
20 0.61
21 0.64
22 0.65
23 0.71
24 0.71
25 0.71
26 0.65
27 0.61
28 0.64
29 0.58
30 0.47
31 0.37
32 0.3
33 0.26
34 0.3
35 0.29
36 0.27
37 0.27
38 0.3
39 0.32
40 0.32
41 0.32
42 0.28
43 0.26
44 0.25
45 0.24
46 0.22
47 0.23
48 0.25
49 0.21
50 0.18
51 0.16
52 0.16
53 0.17
54 0.17
55 0.14
56 0.15
57 0.14
58 0.14
59 0.14
60 0.13
61 0.12
62 0.1
63 0.09
64 0.05
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.1
72 0.11
73 0.1
74 0.1
75 0.1
76 0.11
77 0.12
78 0.11
79 0.08
80 0.08
81 0.08
82 0.07
83 0.06
84 0.06
85 0.06
86 0.06
87 0.07
88 0.06
89 0.06
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.09
97 0.1
98 0.13
99 0.21
100 0.25
101 0.26
102 0.34
103 0.43
104 0.5
105 0.59
106 0.65
107 0.68
108 0.73
109 0.82
110 0.83
111 0.83
112 0.77
113 0.73
114 0.72
115 0.68
116 0.64
117 0.64
118 0.56
119 0.5
120 0.55
121 0.52
122 0.5
123 0.5
124 0.55
125 0.49
126 0.58
127 0.59
128 0.59
129 0.68
130 0.65
131 0.66
132 0.64
133 0.64
134 0.61
135 0.62
136 0.59
137 0.5
138 0.5
139 0.48
140 0.46
141 0.4
142 0.35
143 0.29
144 0.24
145 0.23
146 0.22
147 0.18
148 0.16
149 0.17
150 0.18
151 0.23
152 0.22
153 0.22
154 0.23
155 0.22
156 0.19
157 0.19
158 0.23
159 0.18