Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E1L8X7

Protein Details
Accession A0A1E1L8X7    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-38RTVNSSKHHSHRKSHSNQPTGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.833, mito 7.5, cyto_mito 6.499, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029790  EFG1/Phd1/StuA  
IPR036887  HTH_APSES_sf  
IPR018004  KilA/APSES_HTH  
IPR003163  Tscrpt_reg_HTH_APSES-type  
Gene Ontology GO:0003677  F:DNA binding  
GO:0048315  P:conidium formation  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
PROSITE View protein in PROSITE  
PS51299  HTH_APSES  
Amino Acid Sequences MVLKKHCPNSPFNFGPRTVNSSKHHSHRKSHSNQPTGSSMSSEKPYPGLHVSSYGGPPAHGSGSGSGSGQPYKYSPQPEQTQTHDNGDGDGDGNGNGNGNTPSQYPQYSYDIRLRYPQGENMHSYPSPPTALQDLPPPPLPPMAGPEQEDGDYAAQSMRMDQTGQIAPVAAKPRVTATLWEDEGTLCFQVDVNGTSVARREDNHMVNGTKLLNVAGMTRGRRDGILKAEKQKHVVKIGPMHLKGVWIPFEKALEFANREKITEMLYPLFVHNISALLYHPANNVAYPSQPQAGIGSQYQLGRPVPAGQKYEYDNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.52
4 0.52
5 0.46
6 0.48
7 0.46
8 0.5
9 0.56
10 0.59
11 0.66
12 0.64
13 0.71
14 0.73
15 0.8
16 0.79
17 0.82
18 0.83
19 0.8
20 0.76
21 0.71
22 0.65
23 0.57
24 0.5
25 0.42
26 0.34
27 0.3
28 0.3
29 0.27
30 0.23
31 0.23
32 0.23
33 0.23
34 0.24
35 0.22
36 0.2
37 0.22
38 0.23
39 0.23
40 0.23
41 0.22
42 0.18
43 0.16
44 0.16
45 0.15
46 0.14
47 0.11
48 0.11
49 0.1
50 0.12
51 0.13
52 0.12
53 0.12
54 0.13
55 0.14
56 0.14
57 0.13
58 0.13
59 0.17
60 0.21
61 0.25
62 0.27
63 0.33
64 0.4
65 0.45
66 0.47
67 0.48
68 0.5
69 0.47
70 0.47
71 0.42
72 0.35
73 0.29
74 0.25
75 0.2
76 0.14
77 0.12
78 0.08
79 0.06
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.07
87 0.09
88 0.09
89 0.11
90 0.13
91 0.14
92 0.15
93 0.17
94 0.22
95 0.23
96 0.25
97 0.3
98 0.29
99 0.3
100 0.32
101 0.31
102 0.3
103 0.3
104 0.32
105 0.3
106 0.31
107 0.33
108 0.3
109 0.32
110 0.27
111 0.26
112 0.21
113 0.18
114 0.17
115 0.14
116 0.13
117 0.13
118 0.13
119 0.13
120 0.18
121 0.18
122 0.19
123 0.2
124 0.19
125 0.17
126 0.17
127 0.16
128 0.11
129 0.13
130 0.14
131 0.15
132 0.15
133 0.16
134 0.16
135 0.15
136 0.15
137 0.12
138 0.09
139 0.08
140 0.06
141 0.06
142 0.05
143 0.05
144 0.06
145 0.05
146 0.05
147 0.06
148 0.06
149 0.09
150 0.09
151 0.09
152 0.08
153 0.08
154 0.08
155 0.11
156 0.14
157 0.11
158 0.1
159 0.1
160 0.12
161 0.14
162 0.14
163 0.13
164 0.13
165 0.17
166 0.18
167 0.18
168 0.17
169 0.14
170 0.15
171 0.13
172 0.1
173 0.06
174 0.05
175 0.05
176 0.06
177 0.07
178 0.07
179 0.08
180 0.09
181 0.09
182 0.09
183 0.1
184 0.11
185 0.11
186 0.11
187 0.15
188 0.21
189 0.23
190 0.25
191 0.27
192 0.26
193 0.25
194 0.26
195 0.22
196 0.15
197 0.13
198 0.11
199 0.08
200 0.08
201 0.08
202 0.1
203 0.13
204 0.13
205 0.15
206 0.16
207 0.16
208 0.17
209 0.18
210 0.19
211 0.24
212 0.32
213 0.36
214 0.44
215 0.51
216 0.52
217 0.56
218 0.58
219 0.54
220 0.51
221 0.49
222 0.45
223 0.44
224 0.49
225 0.52
226 0.46
227 0.43
228 0.38
229 0.36
230 0.32
231 0.28
232 0.25
233 0.2
234 0.21
235 0.2
236 0.21
237 0.2
238 0.2
239 0.19
240 0.18
241 0.2
242 0.21
243 0.29
244 0.28
245 0.28
246 0.28
247 0.27
248 0.26
249 0.25
250 0.26
251 0.18
252 0.19
253 0.19
254 0.19
255 0.2
256 0.16
257 0.14
258 0.11
259 0.1
260 0.09
261 0.09
262 0.09
263 0.11
264 0.12
265 0.13
266 0.13
267 0.15
268 0.15
269 0.15
270 0.17
271 0.14
272 0.16
273 0.17
274 0.19
275 0.19
276 0.18
277 0.19
278 0.19
279 0.2
280 0.21
281 0.19
282 0.18
283 0.19
284 0.2
285 0.2
286 0.22
287 0.2
288 0.19
289 0.2
290 0.25
291 0.29
292 0.34
293 0.37
294 0.35
295 0.39