Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E1K7I7

Protein Details
Accession A0A1E1K7I7   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
4-34MNGYTVTPNHRQNRRRERPGSRTRRTITRKAHydrophilic
NLS Segment(s)
PositionSequence
17-28RRRERPGSRTRR
Subcellular Location(s) nucl 15, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MFTMNGYTVTPNHRQNRRRERPGSRTRRTITRKASVHFDLHEGIIDAHDAEIYLPSHRAKPSPLLRQNFDQNWQRWKARQAEEKAVAEMDRFQAEKEQLLLFGGELGDDELYRLGILYNDNEDLPQDFESSTIACDVPFQQSVPMFTLRQDTPQSLPPLALECPNHDNTASVSSPHRILGFNSGDWTFIHTPYHADLSSSPSSEPETWILIDDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.77
4 0.82
5 0.85
6 0.86
7 0.87
8 0.88
9 0.92
10 0.92
11 0.88
12 0.87
13 0.82
14 0.83
15 0.8
16 0.79
17 0.76
18 0.75
19 0.72
20 0.65
21 0.68
22 0.61
23 0.56
24 0.47
25 0.41
26 0.33
27 0.27
28 0.25
29 0.18
30 0.14
31 0.11
32 0.1
33 0.07
34 0.06
35 0.05
36 0.05
37 0.04
38 0.06
39 0.07
40 0.07
41 0.09
42 0.11
43 0.15
44 0.16
45 0.18
46 0.18
47 0.27
48 0.34
49 0.42
50 0.49
51 0.51
52 0.53
53 0.56
54 0.62
55 0.54
56 0.53
57 0.5
58 0.46
59 0.48
60 0.5
61 0.48
62 0.43
63 0.48
64 0.5
65 0.49
66 0.54
67 0.52
68 0.54
69 0.56
70 0.54
71 0.48
72 0.4
73 0.32
74 0.24
75 0.2
76 0.13
77 0.09
78 0.08
79 0.08
80 0.11
81 0.11
82 0.11
83 0.12
84 0.11
85 0.09
86 0.1
87 0.09
88 0.06
89 0.06
90 0.05
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.06
106 0.07
107 0.07
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.08
117 0.07
118 0.07
119 0.07
120 0.06
121 0.05
122 0.06
123 0.07
124 0.1
125 0.1
126 0.1
127 0.11
128 0.12
129 0.13
130 0.15
131 0.16
132 0.14
133 0.14
134 0.19
135 0.17
136 0.21
137 0.21
138 0.21
139 0.21
140 0.27
141 0.29
142 0.24
143 0.24
144 0.2
145 0.21
146 0.2
147 0.21
148 0.16
149 0.17
150 0.22
151 0.23
152 0.24
153 0.21
154 0.21
155 0.19
156 0.23
157 0.19
158 0.16
159 0.17
160 0.18
161 0.19
162 0.2
163 0.2
164 0.16
165 0.17
166 0.23
167 0.23
168 0.22
169 0.24
170 0.22
171 0.22
172 0.21
173 0.26
174 0.2
175 0.19
176 0.2
177 0.17
178 0.19
179 0.21
180 0.25
181 0.18
182 0.18
183 0.18
184 0.23
185 0.26
186 0.25
187 0.22
188 0.19
189 0.24
190 0.24
191 0.26
192 0.21
193 0.2
194 0.2