Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E1KTP5

Protein Details
Accession A0A1E1KTP5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-78FPSDRRGRHAHSQHRRRRSHSRRRHSADGRFKKESBasic
NLS Segment(s)
PositionSequence
48-80RRGRHAHSQHRRRRSHSRRRHSADGRFKKESPR
Subcellular Location(s) nucl 8, plas 5, extr 5, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MVILGGLELVAVGYVIHKHAQNKKEKQRIAEEAAALEEQQYRVFPSDRRGRHAHSQHRRRRSHSRRRHSADGRFKKESPRPLMPDSRPPQYNAAPVPMQKPFQRPSTYPQPFQSPNAPLQPPQQRPQPQMQAQLQPQHRHQSQPQAQYPPDIKYGWIDEPARPALQQDPYFPPTGWPAHWEQSRTAGPQIPESSRGRQERRPESPHVRFAPPRHTASVRSSSRSPPPSYRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.1
4 0.13
5 0.21
6 0.3
7 0.38
8 0.48
9 0.58
10 0.67
11 0.75
12 0.76
13 0.75
14 0.75
15 0.74
16 0.71
17 0.64
18 0.55
19 0.45
20 0.42
21 0.36
22 0.26
23 0.2
24 0.15
25 0.11
26 0.11
27 0.1
28 0.11
29 0.14
30 0.16
31 0.17
32 0.24
33 0.33
34 0.36
35 0.42
36 0.45
37 0.48
38 0.56
39 0.64
40 0.66
41 0.67
42 0.75
43 0.78
44 0.83
45 0.84
46 0.81
47 0.83
48 0.83
49 0.83
50 0.83
51 0.85
52 0.86
53 0.87
54 0.9
55 0.87
56 0.86
57 0.86
58 0.86
59 0.82
60 0.76
61 0.69
62 0.68
63 0.66
64 0.64
65 0.61
66 0.58
67 0.56
68 0.56
69 0.63
70 0.57
71 0.61
72 0.56
73 0.54
74 0.48
75 0.44
76 0.43
77 0.37
78 0.38
79 0.29
80 0.28
81 0.24
82 0.24
83 0.24
84 0.22
85 0.23
86 0.21
87 0.26
88 0.25
89 0.3
90 0.32
91 0.31
92 0.35
93 0.44
94 0.45
95 0.43
96 0.41
97 0.41
98 0.39
99 0.4
100 0.38
101 0.29
102 0.28
103 0.3
104 0.29
105 0.24
106 0.29
107 0.36
108 0.35
109 0.36
110 0.41
111 0.42
112 0.44
113 0.5
114 0.51
115 0.46
116 0.49
117 0.49
118 0.47
119 0.45
120 0.49
121 0.47
122 0.42
123 0.42
124 0.43
125 0.4
126 0.39
127 0.39
128 0.42
129 0.45
130 0.5
131 0.52
132 0.49
133 0.48
134 0.48
135 0.48
136 0.39
137 0.35
138 0.27
139 0.22
140 0.19
141 0.22
142 0.19
143 0.21
144 0.2
145 0.18
146 0.22
147 0.24
148 0.22
149 0.19
150 0.19
151 0.18
152 0.23
153 0.23
154 0.24
155 0.28
156 0.3
157 0.32
158 0.3
159 0.28
160 0.25
161 0.26
162 0.23
163 0.2
164 0.22
165 0.28
166 0.31
167 0.31
168 0.29
169 0.33
170 0.36
171 0.34
172 0.33
173 0.3
174 0.28
175 0.32
176 0.35
177 0.3
178 0.33
179 0.34
180 0.37
181 0.42
182 0.49
183 0.49
184 0.52
185 0.6
186 0.64
187 0.69
188 0.69
189 0.7
190 0.73
191 0.75
192 0.77
193 0.72
194 0.69
195 0.67
196 0.66
197 0.66
198 0.62
199 0.59
200 0.56
201 0.54
202 0.51
203 0.52
204 0.57
205 0.52
206 0.51
207 0.5
208 0.51
209 0.57
210 0.59
211 0.58