Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E1KN08

Protein Details
Accession A0A1E1KN08   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-45LAGGNKSKRKRPPRDSRVSLGHydrophilic
NLS Segment(s)
PositionSequence
30-38KSKRKRPPR
Subcellular Location(s) mito 14.5, cyto_mito 10.166, cyto_nucl 6.333, nucl 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEMYFRWQVVSRMKPISATWRSDDLAGGNKSKRKRPPRDSRVSLGHVCGFGSASASMRILAGSRSDHSDYRGKSWGFKVATGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.42
4 0.38
5 0.37
6 0.34
7 0.34
8 0.34
9 0.33
10 0.32
11 0.23
12 0.26
13 0.23
14 0.23
15 0.23
16 0.28
17 0.31
18 0.38
19 0.46
20 0.5
21 0.59
22 0.66
23 0.74
24 0.8
25 0.86
26 0.84
27 0.79
28 0.74
29 0.68
30 0.58
31 0.48
32 0.38
33 0.28
34 0.23
35 0.17
36 0.12
37 0.08
38 0.08
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.07
48 0.08
49 0.09
50 0.11
51 0.15
52 0.18
53 0.19
54 0.23
55 0.3
56 0.3
57 0.32
58 0.39
59 0.35
60 0.37
61 0.39
62 0.44
63 0.38