Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E1K6A2

Protein Details
Accession A0A1E1K6A2    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
148-170FSTPEPKKRGRPSKKDAERKQQEBasic
232-251GSSGKRRRPKALPKSSKTAAHydrophilic
NLS Segment(s)
PositionSequence
153-166PKKRGRPSKKDAER
235-249GKRRRPKALPKSSKT
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MDVRPWSDSEKRYVLAEAIKCSQVPFDSLFNFVKSQFPVTAWPWEDMLLPNGRTLKQCKEAFEDPRLGSSVPDFQHQVQSQVQSLSPSLPVPTSSATSSGAKRKSNYDSYSPGHPLKRRQSIADPITTARDIRPKPSNTGSHLSQPTFSTPEPKKRGRPSKKDAERKQQEMIARGDILPPVSSVLGYQPSVEDGSIPGYAPILPALTPALHYAPYKPISEAPIHKDIPDSAGSSGKRRRPKALPKSSKTAAKQPGESSFNANPTIDSKVESEETQTITSAATPESVPVASLIEAAKIVPSNFPVTATATELPTATPLPSEQAPDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.35
4 0.33
5 0.32
6 0.32
7 0.3
8 0.3
9 0.29
10 0.22
11 0.21
12 0.19
13 0.2
14 0.2
15 0.25
16 0.26
17 0.25
18 0.26
19 0.24
20 0.25
21 0.23
22 0.25
23 0.21
24 0.21
25 0.24
26 0.26
27 0.32
28 0.3
29 0.3
30 0.27
31 0.26
32 0.26
33 0.22
34 0.24
35 0.2
36 0.19
37 0.21
38 0.23
39 0.24
40 0.27
41 0.31
42 0.34
43 0.38
44 0.41
45 0.41
46 0.46
47 0.51
48 0.53
49 0.53
50 0.53
51 0.44
52 0.43
53 0.41
54 0.33
55 0.27
56 0.23
57 0.24
58 0.18
59 0.2
60 0.21
61 0.2
62 0.28
63 0.28
64 0.3
65 0.26
66 0.28
67 0.27
68 0.26
69 0.25
70 0.18
71 0.18
72 0.15
73 0.13
74 0.12
75 0.11
76 0.1
77 0.1
78 0.1
79 0.11
80 0.12
81 0.12
82 0.13
83 0.15
84 0.17
85 0.2
86 0.26
87 0.3
88 0.31
89 0.33
90 0.37
91 0.41
92 0.45
93 0.45
94 0.43
95 0.44
96 0.43
97 0.46
98 0.45
99 0.43
100 0.41
101 0.42
102 0.45
103 0.48
104 0.54
105 0.52
106 0.51
107 0.52
108 0.55
109 0.54
110 0.48
111 0.4
112 0.32
113 0.33
114 0.29
115 0.24
116 0.17
117 0.22
118 0.2
119 0.24
120 0.31
121 0.31
122 0.35
123 0.41
124 0.43
125 0.4
126 0.44
127 0.4
128 0.4
129 0.4
130 0.36
131 0.31
132 0.28
133 0.24
134 0.23
135 0.21
136 0.22
137 0.23
138 0.32
139 0.38
140 0.42
141 0.49
142 0.56
143 0.67
144 0.69
145 0.75
146 0.73
147 0.78
148 0.82
149 0.85
150 0.83
151 0.83
152 0.79
153 0.73
154 0.67
155 0.59
156 0.51
157 0.45
158 0.39
159 0.28
160 0.22
161 0.19
162 0.17
163 0.14
164 0.12
165 0.08
166 0.07
167 0.06
168 0.06
169 0.05
170 0.05
171 0.06
172 0.08
173 0.07
174 0.07
175 0.07
176 0.08
177 0.08
178 0.08
179 0.07
180 0.05
181 0.07
182 0.07
183 0.07
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.06
195 0.07
196 0.08
197 0.09
198 0.09
199 0.11
200 0.16
201 0.18
202 0.18
203 0.18
204 0.19
205 0.2
206 0.25
207 0.28
208 0.28
209 0.32
210 0.32
211 0.31
212 0.3
213 0.28
214 0.26
215 0.23
216 0.19
217 0.13
218 0.18
219 0.19
220 0.25
221 0.32
222 0.36
223 0.43
224 0.46
225 0.52
226 0.57
227 0.68
228 0.72
229 0.76
230 0.8
231 0.77
232 0.81
233 0.79
234 0.77
235 0.69
236 0.67
237 0.65
238 0.59
239 0.57
240 0.52
241 0.54
242 0.49
243 0.47
244 0.44
245 0.37
246 0.35
247 0.33
248 0.3
249 0.24
250 0.22
251 0.25
252 0.19
253 0.17
254 0.16
255 0.18
256 0.19
257 0.19
258 0.2
259 0.19
260 0.21
261 0.2
262 0.19
263 0.16
264 0.14
265 0.15
266 0.12
267 0.1
268 0.09
269 0.08
270 0.09
271 0.1
272 0.1
273 0.09
274 0.09
275 0.09
276 0.08
277 0.1
278 0.09
279 0.08
280 0.09
281 0.08
282 0.09
283 0.1
284 0.1
285 0.11
286 0.13
287 0.16
288 0.16
289 0.18
290 0.18
291 0.19
292 0.2
293 0.23
294 0.22
295 0.19
296 0.2
297 0.19
298 0.17
299 0.16
300 0.16
301 0.12
302 0.11
303 0.11
304 0.15
305 0.16