Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E1KYC1

Protein Details
Accession A0A1E1KYC1   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-74PGLSSCPRKRRLIKSKRIPSATAHydrophilic
NLS Segment(s)
PositionSequence
60-63KRRL
65-65K
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPTSSTERKTIVDKYKDTQGLQNRNSESMPLPVMRTRIVQFPPPAHQHDSLPGLSSCPRKRRLIKSKRIPSATAFFAVASSAPTIIGVTPQILDTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.55
3 0.56
4 0.53
5 0.52
6 0.51
7 0.53
8 0.52
9 0.55
10 0.48
11 0.46
12 0.44
13 0.38
14 0.3
15 0.23
16 0.22
17 0.16
18 0.16
19 0.16
20 0.18
21 0.17
22 0.18
23 0.17
24 0.2
25 0.21
26 0.24
27 0.24
28 0.25
29 0.29
30 0.31
31 0.33
32 0.31
33 0.3
34 0.26
35 0.27
36 0.27
37 0.22
38 0.2
39 0.16
40 0.14
41 0.16
42 0.23
43 0.26
44 0.3
45 0.35
46 0.41
47 0.5
48 0.59
49 0.67
50 0.71
51 0.76
52 0.81
53 0.86
54 0.86
55 0.82
56 0.73
57 0.66
58 0.6
59 0.51
60 0.42
61 0.32
62 0.23
63 0.2
64 0.18
65 0.13
66 0.1
67 0.08
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08