Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8B9R9

Protein Details
Accession G8B9R9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
152-183DSMPQRHRFRVKKLSGRTKRPKIRNYESGFKIHydrophilic
NLS Segment(s)
PositionSequence
158-174HRFRVKKLSGRTKRPKI
Subcellular Location(s) mito 11, nucl 9, cyto_nucl 8.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MRGYSFSFPKIEKNILKGVKDFTTIDSFPISSINVTPKKVVSKFVQNSPSLAENENKFRSRNSFIIARSTLSSLLKENTYELKIVSKGVSNLWSHVDTSFKTYFKYLSLIESMWHDKKRSSYNSILRVNKVHTLTNSEHSSSPLSRDNNAHDSMPQRHRFRVKKLSGRTKRPKIRNYESGFKISSTSLSCNYGIVTEDIFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.52
4 0.48
5 0.47
6 0.4
7 0.39
8 0.35
9 0.3
10 0.31
11 0.28
12 0.27
13 0.24
14 0.22
15 0.19
16 0.19
17 0.16
18 0.11
19 0.13
20 0.2
21 0.22
22 0.23
23 0.25
24 0.27
25 0.34
26 0.34
27 0.37
28 0.34
29 0.4
30 0.44
31 0.5
32 0.53
33 0.46
34 0.45
35 0.43
36 0.41
37 0.32
38 0.29
39 0.26
40 0.23
41 0.29
42 0.33
43 0.33
44 0.3
45 0.31
46 0.34
47 0.36
48 0.35
49 0.32
50 0.32
51 0.31
52 0.36
53 0.35
54 0.3
55 0.26
56 0.24
57 0.23
58 0.18
59 0.18
60 0.13
61 0.14
62 0.13
63 0.12
64 0.13
65 0.14
66 0.14
67 0.13
68 0.12
69 0.13
70 0.13
71 0.13
72 0.12
73 0.11
74 0.1
75 0.11
76 0.15
77 0.13
78 0.13
79 0.15
80 0.14
81 0.14
82 0.13
83 0.14
84 0.1
85 0.15
86 0.17
87 0.15
88 0.15
89 0.15
90 0.15
91 0.15
92 0.17
93 0.12
94 0.11
95 0.12
96 0.11
97 0.11
98 0.13
99 0.17
100 0.18
101 0.2
102 0.19
103 0.19
104 0.24
105 0.31
106 0.33
107 0.35
108 0.4
109 0.45
110 0.53
111 0.6
112 0.58
113 0.53
114 0.5
115 0.46
116 0.43
117 0.37
118 0.31
119 0.24
120 0.27
121 0.27
122 0.31
123 0.3
124 0.27
125 0.26
126 0.25
127 0.27
128 0.22
129 0.23
130 0.24
131 0.24
132 0.25
133 0.27
134 0.31
135 0.32
136 0.33
137 0.3
138 0.26
139 0.3
140 0.36
141 0.42
142 0.45
143 0.44
144 0.49
145 0.59
146 0.63
147 0.67
148 0.69
149 0.7
150 0.71
151 0.78
152 0.83
153 0.83
154 0.88
155 0.89
156 0.89
157 0.9
158 0.9
159 0.88
160 0.87
161 0.86
162 0.85
163 0.82
164 0.81
165 0.74
166 0.7
167 0.62
168 0.53
169 0.45
170 0.36
171 0.32
172 0.25
173 0.24
174 0.22
175 0.24
176 0.24
177 0.22
178 0.22
179 0.19
180 0.18
181 0.15