Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E1LII6

Protein Details
Accession A0A1E1LII6   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-50VFVILRKKDKKEKIWVHLKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 8.5, mito 7, cyto 3.5, pero 1, E.R. 1, golg 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013736  Xaa-Pro_dipept_C  
Gene Ontology GO:0008239  F:dipeptidyl-peptidase activity  
Pfam View protein in Pfam  
PF08530  PepX_C  
Amino Acid Sequences MQAHLRSDSPTHWPPKTIPYVPPLDGNVFTVFVILRKKDKKEKIWVHLKFPLAAKSTKSIDDIAEKFQMSLNLYPGSNGILSASNQAVDSSRSIYPQFQFNPHTKQDKVEPGTVITLNLGIRDMGVDFDAGENISVREKFHHAITIQSSQQRSGSHGSKVNIQVLRTLKASQIQDQRES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.53
4 0.49
5 0.45
6 0.44
7 0.47
8 0.46
9 0.46
10 0.39
11 0.34
12 0.3
13 0.29
14 0.24
15 0.19
16 0.17
17 0.15
18 0.12
19 0.12
20 0.16
21 0.16
22 0.23
23 0.29
24 0.37
25 0.46
26 0.55
27 0.61
28 0.67
29 0.74
30 0.76
31 0.8
32 0.76
33 0.73
34 0.69
35 0.62
36 0.54
37 0.47
38 0.42
39 0.35
40 0.33
41 0.28
42 0.27
43 0.27
44 0.25
45 0.25
46 0.2
47 0.19
48 0.23
49 0.23
50 0.21
51 0.22
52 0.2
53 0.19
54 0.19
55 0.19
56 0.15
57 0.15
58 0.14
59 0.13
60 0.13
61 0.13
62 0.12
63 0.11
64 0.09
65 0.08
66 0.06
67 0.06
68 0.07
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.08
78 0.09
79 0.1
80 0.1
81 0.13
82 0.13
83 0.18
84 0.18
85 0.19
86 0.22
87 0.25
88 0.3
89 0.32
90 0.36
91 0.31
92 0.32
93 0.34
94 0.39
95 0.39
96 0.36
97 0.32
98 0.28
99 0.29
100 0.27
101 0.22
102 0.14
103 0.12
104 0.09
105 0.09
106 0.08
107 0.06
108 0.05
109 0.05
110 0.06
111 0.04
112 0.05
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.08
122 0.09
123 0.09
124 0.12
125 0.15
126 0.17
127 0.18
128 0.22
129 0.2
130 0.24
131 0.28
132 0.3
133 0.3
134 0.34
135 0.34
136 0.3
137 0.33
138 0.29
139 0.28
140 0.3
141 0.3
142 0.31
143 0.35
144 0.35
145 0.4
146 0.43
147 0.46
148 0.42
149 0.39
150 0.4
151 0.37
152 0.39
153 0.33
154 0.31
155 0.26
156 0.31
157 0.34
158 0.36
159 0.41